Property Summary

NCBI Gene PubMed Count 20
PubMed Score 71.51
PubTator Score 396.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -2.029 2.7e-03
medulloblastoma, large-cell 1.100 2.2e-04
pancreatic ductal adenocarcinoma liver m... -1.077 3.8e-03
breast carcinoma -1.400 9.8e-04
fibroadenoma -1.800 3.2e-02
ductal carcinoma in situ -3.500 1.1e-04
invasive ductal carcinoma -3.600 1.3e-03
ovarian cancer 1.100 1.0e-09

Gene RIF (8)

PMID Text
26149650 Data indicate that Afrikaner caucasians have a Q61L single nucleotide polymorphism (SNP) occurring at a high frequency (12%).
23237781 SNP variations causing amino acid substitutions in the human GLYAT gene influence the kinetic properties of the enzyme.
23108985 We identify GLYAT gene which appears to co-regulate bone size phenotypes (BSPs) and appendicular lean mass (ALM).
22475485 hGLYAT is a good candidate as a novel marker of hepatocellular carcinoma and may be a key molecule in the transition between differentiation and carcinogenesis of liver cells.
20925583 The aim of this work was to report a comprehensive investigation of GLYAT genetic polymorphisms in DNA samples from 55 subjects of French Caucasian origin.
20925583 Observational study of genotype prevalence. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
19252341 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLD      1 - 70
HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETA     71 - 140
KELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFWHFGGNERSQRFIERCIQTFPTCCLL    141 - 210
GPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQ    211 - 280
HVPIPRSWNQWNCVPL                                                          281 - 296
//

Text Mined References (22)

PMID Year Title
26149650 2015 Conservation of the coding regions of the glycine N-acyltransferase gene further suggests that glycine conjugation is an essential detoxification pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23237781 2013 Characterisation of the influence of genetic variations on the enzyme activity of a recombinant human glycine N-acyltransferase.
23108985 2013 Suggestion of GLYAT gene underlying variation of bone size and body lean mass as revealed by a bivariate genome-wide association study.
22475485 2012 Designation of enzyme activity of glycine-N-acyltransferase family genes and depression of glycine-N-acyltransferase in human hepatocellular carcinoma.
20925583 2010 Genetic polymorphisms of glycine N-acyltransferase (GLYAT) in a French Caucasian population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19252341 2009 Genetic polymorphisms of glycine N-acyltransferase in Japanese individuals.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
13174534 1954 Glycine N-acylase: purification and properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10630424 2000 The utilization of alanine, glutamic acid, and serine as amino acid substrates for glycine N-acyltransferase.
9202629 1997 Developmental profile of mitochondrial glycine N-acyltransferase in human liver.
8660675 1996 Fatty acid amide biosynthesis: a possible new role for peptidylglycine alpha-amidating enzyme and acyl-coenzyme A: glycine N-acyltransferase.
7833837 1994 An immunodetection method for the quantitation of human acyl CoA:glycine N-acyltransferase in biological samples.
7802672 1994 Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.
931988 1976 Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.