Property Summary

NCBI Gene PubMed Count 27
PubMed Score 78.18
PubTator Score 46.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.3e-147
ulcerative colitis 2087 5.4e-08
interstitial cystitis 2299 8.6e-06
diabetes mellitus 1663 1.1e-03
group 4 medulloblastoma 1875 6.2e-03
spina bifida 1064 3.5e-02
Disease Target Count Z-score Confidence
Venous insufficiency 6 3.4 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
interstitial cystitis -1.200 8.6e-06
group 4 medulloblastoma -1.200 6.2e-03
psoriasis 1.500 2.3e-147
spina bifida -1.800 3.5e-02
ulcerative colitis -1.200 5.4e-08

Synonym

Accession Q9NZD2 Q53Z13 Q96J68 GLTP
Symbols

Gene

PANTHER Protein Class (1)

PDB

1SWX   1SX6   2EUK   2EUM   2EVD   2EVL   2EVS   2EVT   3RIC   3RWV   3RZN   3S0I   3S0K   4GH0   4GHP   4GHS   4GIX   4GJQ   4GVT   4GXD   4GXG   4H2Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (19)

PMID Text
24824606 GLTP not only could be a significant player in cellular sphingolipid metabolism, but also could have a much broader role in the overall lipid metabolism.
23555818 GLTP mediates non-vesicular transport of ganglioside GM1 between native membranes
23519669 Comprehensive analysis of the dimerization interfaces discloses -helices 6 and 2 and the protein C-terminus (C-end) as three specific structural elements that are simultaneously involved in dimer formation and ligand binding by GLTP.
21625605 findings represent the first known phenotypic changes triggered by GLTP overexpression and regulated by direct interaction with a p120-catenin protein family member
20974858 This study represents the first characterization of any Gltp gene promoter and links human GLTP expression to sphingolipid homeostasis through ceramide
20959104 remarkable versatility for Trp, providing three distinct intramolecular functions in the novel amphitropic GLTP fold
19665998 GLTP and VAP-A were shown to interact.
19270338 Glycolipid acquisition by human glycolipid transfer protein dramatically alters intrinsic tryptophan fluorescence: insights into glycolipid binding affinity.
18657186 transgenic expression in Arabidopsis thaliana of human GLTP partially suppressed the phenotype of the acd11 null mutant, resulting in delayed programmed cell death development and plant survival
18261224 Active transcription was found for 12q24.11 GLTP but 11p15.1 GLTP was transcriptionally silent.
18261224 A single-copy 5-exon/4-intron GLTP gene at 12q24.11 was the highly conserved, transcript source of active GLTP in human and vertebrate cells. An intronless GLTP gene at 11p15.1 was transcriptionally silent, primate-specific, and yielded inactive protein.
17980653 GLTP is not likely involved in the de novo synthesis of glycosphingolipids, but could rather have a role as a glycolipid sensor for the cellular levels of glucosylceramide.
15901739 analysis of the liganding site in human glycolipid transfer protein
15504043 The rate-limiting step for glycolipid transfer protein (GLTP) action appears to be the surface processes leading to the GLTP-glycosphingolipid complex formation and release associated with a shuttle/carrier mode of action.
15329726 crystal structures of apo-GLTP (1.65 A resolution) and lactosylceramide-bound (1.95 A) GLTP, in which the bound glycosphingolipid is sandwiched, after adaptive recognition, within a previously unknown two-layer all-alpha-helical topology
15287756 First insights into human GLTP structural dynamics by fluorescence spectroscopy, including global conformational changes that accompany GLTP folding into an active conformational state.
10671554 This paper describes the first cloning of the cDNAs encoding the glycolipid transfer proteins of bovine and porcine brain. The cDNAs are highly homologous to the human cDNA (AF209704).
10653652 This paper shows that the rate at which glycolipid transfer protein catalyzes the intermembrane transfer of glycolipids is greatly diminished by increasing the charged lipid content of membranes.
2190982 The paper describes the complete primary amino acid sequence of glycolipid transfer protein (GLTP) from porcine brain. The sequence was determined by Edman degradation.

AA Sequence

MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL      1 - 70
QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH     71 - 140
GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV     141 - 209
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24824606 2014 Alternation in the glycolipid transfer protein expression causes changes in the cellular lipidome.
23555818 2013 GLTP mediated non-vesicular GM1 transport between native membranes.
23519669 2013 Structural insights into lipid-dependent reversible dimerization of human GLTP.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21625605 2011 Human glycolipid transfer protein (GLTP) expression modulates cell shape.
21269460 2011 Initial characterization of the human central proteome.
20974858 2011 Human glycolipid transfer protein gene (GLTP) expression is regulated by Sp1 and Sp3: involvement of the bioactive sphingolipid ceramide.
20959104 2010 Human GLTP: Three distinct functions for the three tryptophans in a novel peripheral amphitropic fold.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
19665998 2009 The glycolipid transfer protein interacts with the vesicle-associated membrane protein-associated protein VAP-A.
19270338 2009 Glycolipid acquisition by human glycolipid transfer protein dramatically alters intrinsic tryptophan fluorescence: insights into glycolipid binding affinity.
18657186 2008 Human GLTP and mutant forms of ACD11 suppress cell death in the Arabidopsis acd11 mutant.
18261224 2008 Human glycolipid transfer protein (GLTP) genes: organization, transcriptional status and evolution.
17980653 2007 Human glycolipid transfer protein--intracellular localization and effects on the sphingolipid synthesis.
17320476 2007 Glycolipid transfer proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17105344 2006 The liganding of glycolipid transfer protein is controlled by glycolipid acyl structure.
16169991 2005 Glycolipid transfer protein interaction with bilayer vesicles: modulation by changing lipid composition.
15901739 2005 Point mutational analysis of the liganding site in human glycolipid transfer protein. Functionality of the complex.
15504043 2004 Glycolipid transfer protein mediated transfer of glycosphingolipids between membranes: a model for action based on kinetic and thermodynamic analyses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329726 2004 Structural basis for glycosphingolipid transfer specificity.
15287756 2004 Human glycolipid transfer protein: probing conformation using fluorescence spectroscopy.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10671554 2000 Cloning and expression of glycolipid transfer protein from bovine and porcine brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2190982 1990 Primary structure of glycolipid transfer protein from pig brain.