Property Summary

NCBI Gene PubMed Count 29
PubMed Score 84.38
PubTator Score 46.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
group 4 medulloblastoma -1.200 6.2e-03
interstitial cystitis -1.200 8.6e-06
psoriasis 1.100 9.4e-15
spina bifida -1.800 3.5e-02
ulcerative colitis -1.200 5.4e-08

PDB (22)

Gene RIF (20)

AA Sequence

MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL      1 - 70
QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH     71 - 140
GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV     141 - 209
//

Text Mined References (31)

PMID Year Title