Property Summary

Ligand Count 497
NCBI Gene PubMed Count 79
PubMed Score 795.34
PubTator Score 146.61

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.718 1.9
Heart disease 306 3.702 1.9
Acute endometritis 1 3.266 1.6


  Differential Expression (35)

Disease log2 FC p
active Crohn's disease -1.229 8.2e-03
adult high grade glioma -2.400 1.8e-04
aldosterone-producing adenoma -1.509 2.4e-02
Alzheimer's disease -1.400 3.5e-02
astrocytic glioma -2.200 1.3e-03
Astrocytoma, Pilocytic -2.500 1.2e-08
Atopic dermatitis 1.300 2.5e-04
atypical teratoid / rhabdoid tumor -2.800 2.5e-12
autosomal dominant Emery-Dreifuss muscul... 1.058 1.9e-03
cutaneous lupus erythematosus 1.200 5.2e-04
dermatomyositis 1.100 1.1e-02
ependymoma -2.600 6.5e-04
esophageal adenocarcinoma 1.200 2.3e-02
gastric cancer 1.100 5.9e-03
glioblastoma -2.300 2.6e-09
group 3 medulloblastoma -2.500 1.8e-03
interstitial cystitis 1.200 5.8e-04
juvenile dermatomyositis 1.112 2.2e-09
lung cancer -1.600 2.8e-03
lung carcinoma -1.400 2.6e-19
malignant mesothelioma -2.900 7.1e-09
medulloblastoma, large-cell -2.200 1.1e-04
nasopharyngeal carcinoma 1.600 1.2e-03
nephrosclerosis -1.036 5.3e-03
non-small cell lung cancer -1.322 6.0e-09
oligodendroglioma -1.900 1.6e-02
osteosarcoma -1.503 1.6e-03
ovarian cancer -1.600 8.1e-14
Pick disease -2.500 1.1e-03
pituitary cancer 1.200 7.1e-04
primitive neuroectodermal tumor -2.100 1.1e-04
psoriasis -3.200 1.8e-05
subependymal giant cell astrocytoma -2.236 3.3e-02
tuberculosis -1.200 3.6e-06
ulcerative colitis -1.100 1.8e-04

 GO Function (1)

PDB (22)

Gene RIF (60)

AA Sequence

GHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL                                   631 - 669

Text Mined References (86)

PMID Year Title