Property Summary

NCBI Gene PubMed Count 34
PubMed Score 85.03
PubTator Score 43.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Cardiomegaly 66
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 1.2e-19
psoriasis 6685 3.9e-13
malignant mesothelioma 3163 6.0e-06
osteosarcoma 7933 4.5e-05
lung cancer 4473 4.2e-03
ovarian cancer 8491 1.8e-02
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 6.0e-06
psoriasis 1.400 3.9e-13
osteosarcoma -1.458 4.5e-05
non-small cell lung cancer 1.236 1.2e-19
lung cancer 1.300 4.2e-03
ovarian cancer 1.100 1.8e-02

Gene RIF (16)

PMID Text
26613676 apo GRX3 and apo BOLA2 form a heterotrimeric complex, composed by two BOLA2 molecules and one GRX3 molecule
26302480 These findings provide an advanced view of the functional role of glutaredoxin-3 in iron metabolism.
26296460 These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation.
25975981 findings provide novel insights into the regulation of Grx3, which is crucial for cell survival against environmental insults
23615448 Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation.
23415866 these data raise the possibility that the pro-apoptotic role of PICOT is actively regulated via caspase-3-mediated cleavage.
22309771 the unusual [2Fe-2S]-bridging Grx-BolA interaction is conserved in higher eukaryotes and may play a role in signaling cellular iron status in humans.
21575136 investigations into role of Grx3: Grx3-knockdown in HeLa cells leads to significant delay in mitotic exit and a higher percentage of binucleated cells.
21123948 analysis of primary breast cancer samples demonstrated that enhanced TXNL2 expression correlated with metastasis to the lung and brain and with decreased overall patient survival
20800603 Observational study of gene-disease association. (HuGE Navigator)
20498481 Demonstrated a differential expression of PICOT in various cell types, with a predominant cytosolic staining of epithelial cells and low or undetectable levels of PICOT in the stroma.
20226171 redox-induced dissociation of the Grx3/PICOT holo complex may be a mechanism of Grx3/PICOT activation in response to reactive oxygen and nitrogen species.
20170406 The present results show a direct correlation between PICOT expression levels and increased cell growth, both in vitro and in vivo.
19797004 Western blot analysis revealed consistent and preferential expression of Glrx3 in lung and colon cancers; results suggest that Glrx3 could take a pivotal role in colon and lung cancer cells during tumorigenesis
18528843 thioredoxin-like 2 may have a role in colorectal cancer, as it is the antigen for the monoclonal antibody MC3 specific to colorectal cancer
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA      1 - 70
EGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL     71 - 140
THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI    141 - 210
GGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYET    211 - 280
FDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN                   281 - 335
//

Text Mined References (41)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26613676 2015 Elucidating the Molecular Function of Human BOLA2 in GRX3-Dependent Anamorsin Maturation Pathway.
26302480 2015 N-terminal domains mediate [2Fe-2S] cluster transfer from glutaredoxin-3 to anamorsin.
26296460 2015 Human glutaredoxin 3 can bind and effectively transfer [4Fe-4S] cluster to apo-iron regulatory protein 1.
25975981 2015 Nuclear glutaredoxin 3 is critical for protection against oxidative stress-induced cell death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23615448 2013 Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.
23415866 2013 Caspase-3-mediated cleavage of PICOT in apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22309771 2012 Human glutaredoxin 3 forms [2Fe-2S]-bridged complexes with human BolA2.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21575136 2011 A mammalian monothiol glutaredoxin, Grx3, is critical for cell cycle progression during embryogenesis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21160409 2011 Common human genetic variants and HIV-1 susceptibility: a genome-wide survey in a homogeneous African population.
21123948 2011 Thioredoxin-like 2 regulates human cancer cell growth and metastasis via redox homeostasis and NF-?B signaling.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20498481 2010 Widespread expression of PICOT in mouse and human tissues with predominant localization to epithelium.
20226171 2010 Characterization of the human monothiol glutaredoxin 3 (PICOT) as iron-sulfur protein.
20170406 2010 Hodgkin's lymphoma cells exhibit high expression levels of the PICOT protein.
19797004 2009 Preferential overexpression of glutaredoxin3 in human colon and lung carcinoma.
18528843 2008 Identification and distribution of thioredoxin-like 2 as the antigen for the monoclonal antibody MC3 specific to colorectal cancer.
18258855 2008 PICOT attenuates cardiac hypertrophy by disrupting calcineurin-NFAT signaling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11774602 2001 Tyrosine phosphorylation of PICOT and its translocation to the nucleus in response of human T cells to oxidative stress.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
10636891 2000 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.