Property Summary

Ligand Count 14
NCBI Gene PubMed Count 39
PubMed Score 18.00
PubTator Score 29.82

Knowledge Summary

Patent (1,370)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Hyperexplexia hereditary 4 0.0 0.0
Disease Target Count
General anesthesia 53
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Hyperekplexia 16 7.334 3.7
Disease Target Count Z-score Confidence
Agoraphobia 21 3.871 1.9
Panic disorder 61 3.545 1.8

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 2.4e-02
aldosterone-producing adenoma -1.211 1.5e-02
astrocytic glioma -1.300 2.0e-02
Atopic dermatitis -1.100 6.7e-08
atypical teratoid / rhabdoid tumor -2.300 5.5e-05
Breast cancer -1.100 3.5e-02
ductal carcinoma in situ -1.500 6.8e-03
ependymoma -1.100 3.8e-02
glioblastoma -1.200 3.3e-03
group 3 medulloblastoma -1.600 4.6e-02
Hydrolethalus syndrome 1.027 3.9e-02
intraductal papillary-mucinous adenoma (... -2.000 6.2e-04
intraductal papillary-mucinous carcinoma... -1.200 1.7e-03
lung cancer 1.700 1.2e-04
lung carcinoma 1.300 1.9e-06
medulloblastoma, large-cell -2.300 1.2e-04
oligodendroglioma -1.500 3.3e-02
osteosarcoma 1.985 2.7e-04
ovarian cancer 1.600 1.4e-03
Pick disease -2.300 2.0e-03
primitive neuroectodermal tumor -1.700 2.1e-04
psoriasis -1.100 3.7e-06
subependymal giant cell astrocytoma -3.149 1.7e-02

Synonym

Accession P48167 A8K3K2 D3DP23 F5GWE1
Symbols HKPX2

Gene

Gene RIF (22)

AA Sequence

MKFLLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPR      1 - 70
IRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWK     71 - 140
PDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDD    141 - 210
LRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLI    211 - 280
VVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVV    281 - 350
QVMLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDF    351 - 420
SIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNV    421 - 490
IYWSIYL                                                                   491 - 497
//

Text Mined References (47)

PMID Year Title