Property Summary

Ligand Count 13
NCBI Gene PubMed Count 16
PubMed Score 12.88
PubTator Score 22.08

Knowledge Summary

Patent (1,064)

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
inflammatory breast cancer -1.100 1.6e-02
non primary Sjogren syndrome sicca -1.100 2.7e-02
pituitary cancer 1.700 4.8e-04
psoriasis -1.200 3.3e-06

Gene RIF (9)

AA Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPV      1 - 70
NVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAN     71 - 140
FHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQ    141 - 210
VAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMD    211 - 280
AAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRF    281 - 350
RRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV    351 - 420
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD                              421 - 464
//

Text Mined References (16)

PMID Year Title