Property Summary

Ligand Count 45
NCBI Gene PubMed Count 127
PubMed Score 119.03
PubTator Score 139.16

Knowledge Summary

Patent (1,805)

Expression

Protein-protein Interaction (1)

Gene RIF (90)

AA Sequence

MYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVSCN      1 - 70
IFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEIT     71 - 140
TDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGL    141 - 210
TLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPAR    211 - 280
VGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRR    281 - 350
HHKSPMLNLFQEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRA    351 - 420
KKIDKISRIGFPMAFLIFNMFYWIIYKIVRREDVHNQ                                     421 - 457
//

Text Mined References (132)

PMID Year Title