Property Summary

Ligand Count 32
NCBI Gene PubMed Count 115
PubMed Score 366.22
PubTator Score 503.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.100 6.4e-03
lung cancer 1.200 1.5e-02
Multiple myeloma 1.009 1.4e-02
osteosarcoma 1.495 3.8e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (99)

AA Sequence

MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSL      1 - 70
YFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK     71 - 140
RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM                              141 - 184
//

Text Mined References (124)

PMID Year Title