Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.93
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma -1.500 4.0e-02
glioblastoma 1.400 9.7e-06
osteosarcoma -1.307 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.377 7.4e-03
tuberculosis 1.300 3.9e-05
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-02
active Crohn's disease 1.115 2.3e-02
pediatric high grade glioma 1.500 7.2e-04
pilocytic astrocytoma 1.500 1.7e-08
aldosterone-producing adenoma -1.037 2.3e-02
subependymal giant cell astrocytoma 2.893 1.3e-02
ovarian cancer 1.700 4.6e-04
sarcoidosis -1.200 2.6e-03

Pathway (1)

Gene RIF (1)

PMID Text
18021396 NCU-G1 is a dual-function protein capable of functioning as a transcription factor as well as a nuclear receptor co-activator.

AA Sequence

MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHY      1 - 70
VWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAA     71 - 140
KPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLL    141 - 210
HTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFA    211 - 280
QWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYL    281 - 350
SWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN                  351 - 406
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19556463 2009 A gene network regulating lysosomal biogenesis and function.
19489740 2009 NCU-G1 is a highly glycosylated integral membrane protein of the lysosome.
18021396 2007 Human NCU-G1 can function as a transcription factor and as a nuclear receptor co-activator.
17897319 2007 Integral and associated lysosomal membrane proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.