Property Summary

NCBI Gene PubMed Count 21
PubMed Score 76.52
PubTator Score 21.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma -1.100 3.5e-03
glioblastoma -1.100 6.4e-04
lung cancer 1.800 2.5e-03
oligodendroglioma -1.100 2.4e-02

Gene RIF (8)

AA Sequence

MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVV      1 - 70
RCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKA     71 - 140
YSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLK    141 - 210
FCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENK    211 - 280
QLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDNS    281 - 350
LLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFI    351 - 420
IQNIKNQIDMSLKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDN    421 - 490
QTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVSGEEIPNMPPEMQLKVLHS    491 - 560
ALFTFDLIESVLARVEELIEIKTKSTSEENIGIK                                        561 - 594
//

Text Mined References (26)

PMID Year Title