Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.39
PubTator Score 23.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -2.000 3.0e-02
astrocytic glioma 1.900 2.4e-03
posterior fossa group A ependymoma 3.300 1.6e-17
glioblastoma multiforme 2.300 1.5e-18
oligodendroglioma 1.100 8.2e-05
group 3 medulloblastoma -2.400 5.9e-04
cystic fibrosis -1.126 3.5e-05
atypical teratoid / rhabdoid tumor 2.000 2.8e-03
medulloblastoma, large-cell -3.100 2.8e-07
pediatric high grade glioma 1.700 1.2e-03
pilocytic astrocytoma 1.500 2.5e-04
subependymal giant cell astrocytoma 2.252 1.6e-02
Pick disease 1.600 1.1e-03
ulcerative colitis 1.100 2.7e-02
ovarian cancer -1.300 4.9e-02
pituitary cancer -3.100 1.3e-09
chronic rhinosinusitis -1.340 3.0e-02
facioscapulohumeral dystrophy -1.500 4.9e-02

Gene RIF (17)

PMID Text
26259131 New findings with GLIS3 phenotype including craniosynostosis, hiatus hernia, atrial septal defect, splenic cyst, and choanal atresia and confirm further cases with sensorineural deafness and exocrine pancreatic insufficiency.
26147758 It may play a role in a number of physiological processes controlled by Glis3.
25122662 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3.
23856252 analysis of a GLIS3 variant that may have a role in resistance to Japanese type 1 diabetes
23737756 The present data suggest that altered expression of the candidate gene GLIS3 may contribute to both type 1 and 2 type diabetes by favouring beta cell apoptosis
21949744 Alleles of single nucleotide polymorphisms in GLIS3 and ADCY5 may confer risk of type 2 diabetes.
21747906 the associations of GLIS3-rs7034200 and CRY2-rs11605924 with fasting glucose, beta cell function, and type 2 diabetes
21543335 Glis3 interacts with Suppressor of Fused (SUFU)
21515849 Children and adolescents carrying glucose-raising alleles of G6PC2, MTNR1B, GCK, and GLIS3 also showed reduced beta-cell function, as indicated by homeostasis model assessment of beta-cell function.
20419449 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378605 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19430480 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18840781 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16715098 results demonstrate a major role for GLIS3 in the development of pancreatic beta cells and the thyroid, eye, liver and kidney

AA Sequence

MMVQRLGLISPPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQ      1 - 70
EWSQGYRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFGTESSHSPYPSPRHSSTRSHS     71 - 140
ARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPANLSPQPEVYGHFLGVRGSCIPQPRPV    141 - 210
PGSQKGVLVAPGGLALPAYGEDGALEHERMQQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTERLEE    211 - 280
FPGSTVDLPPAPPLPPLPPPPGPPPPYHAHAHLHHPELGPHAQQLALPQATLDDDGEMDGIGGKHCCRWI    281 - 350
DCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCE    351 - 420
KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLR    421 - 490
KHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSS    491 - 560
NYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAP    561 - 630
SSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVP    631 - 700
SFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSS    701 - 770
VYTEG                                                                     771 - 775
//

Text Mined References (34)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26259131 2015 Expanding the Clinical Spectrum Associated With GLIS3 Mutations.
26147758 2015 HECT E3 Ubiquitin Ligase Itch Functions as a Novel Negative Regulator of Gli-Similar 3 (Glis3) Transcriptional Activity.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25122662 2015 Genomic analysis of fibrolamellar hepatocellular carcinoma.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23856252 2013 A low-frequency GLIS3 variant associated with resistance to Japanese type 1 diabetes.
23737756 2013 GLIS3, a susceptibility gene for type 1 and type 2 diabetes, modulates pancreatic beta cell apoptosis via regulation of a splice variant of the BH3-only protein Bim.
23562540 2013 GWAS of cerebrospinal fluid tau levels identifies risk variants for Alzheimer's disease.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
22961080 2013 A genome-wide association study identifies GRK5 and RASGRP1 as type 2 diabetes loci in Chinese Hans.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
21949744 2011 Effects of 16 genetic variants on fasting glucose and type 2 diabetes in South Asians: ADCY5 and GLIS3 variants may predispose to type 2 diabetes.
21747906 2011 Variants in GLIS3 and CRY2 are associated with type 2 diabetes and impaired fasting glucose in Chinese Hans.
21543335 2011 Modulation of the transactivation function and stability of Krüppel-like zinc finger protein Gli-similar 3 (Glis3) by Suppressor of Fused.
21515849 2011 Association of genetic Loci with glucose levels in childhood and adolescence: a meta-analysis of over 6,000 children.
21139041 2011 Novel GLIS3 mutations demonstrate an extended multisystem phenotype.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378605 2010 In silico replication of the genome-wide association results of the Type 1 Diabetes Genetics Consortium.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
19901119 2009 Germline genetic variation in an organic anion transporter polypeptide associated with methotrexate pharmacokinetics and clinical effects.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
18840781 2009 Follow-up analysis of genome-wide association data identifies novel loci for type 1 diabetes.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
16715098 2006 Mutations in GLIS3 are responsible for a rare syndrome with neonatal diabetes mellitus and congenital hypothyroidism.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500813 2003 GLIS3, a novel member of the GLIS subfamily of Krüppel-like zinc finger proteins with repressor and activation functions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.