Property Summary

NCBI Gene PubMed Count 31
PubMed Score 31.05
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma -4.500 7.8e-10
oligodendroglioma -1.200 4.6e-02
cutaneous lupus erythematosus 1.500 5.3e-03
psoriasis -1.800 8.2e-05
osteosarcoma -1.673 4.9e-03
glioblastoma 2.700 3.2e-03
atypical teratoid / rhabdoid tumor -1.800 8.7e-06
medulloblastoma -1.300 1.7e-03
medulloblastoma, large-cell -2.100 5.5e-04
chronic kidney disease 1.100 3.7e-02
tuberculosis and treatment for 6 months -1.200 2.8e-02
primary pancreatic ductal adenocarcinoma 1.032 3.8e-02
intraductal papillary-mucinous adenoma (... -2.000 6.2e-03
intraductal papillary-mucinous carcinoma... -2.200 2.9e-03
lung cancer -1.300 1.7e-04
diabetes mellitus -1.400 2.2e-02
interstitial cystitis 1.600 2.3e-05
cystic fibrosis 1.500 2.3e-03
pediatric high grade glioma 1.800 7.2e-04
pilocytic astrocytoma 1.800 1.6e-08
posterior fossa group A ependymoma 1.300 2.4e-03
primary Sjogren syndrome 1.300 1.1e-03
aldosterone-producing adenoma -1.084 3.6e-02
subependymal giant cell astrocytoma 2.918 9.6e-03
lung carcinoma -2.300 4.6e-27
Breast cancer -1.700 3.4e-12
gastric carcinoma 1.800 1.2e-02
ulcerative colitis 2.500 1.8e-05
ovarian cancer -2.300 7.8e-09
pancreatic cancer 1.200 2.9e-02
head and neck cancer -1.200 9.0e-03

Protein-protein Interaction (1)

Gene RIF (21)

PMID Text
26988096 This study reveals a novel pathway that PRMT5/WDR77 regulates GLIPR1 expression to control lung cancer cell growth.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26267319 Overexpression of RTVP-1 in human neural stem cells induced mesenchymal differentiation, whereas silencing of RTVP-1 in glioma stem cells (GSCs) decreased the mesenchymal transformation and stemness of these cells.
24008279 Based on the observed overexpression in AML samples, GliPR1 should be further explored as a potential target for AML
23714687 miR-137 inhibits Glioblastom stem cell self-renewal and promotes their differentiation by targeting RTVP-1 which down-regulates CXCR4.
23433894 Data indicate that combining adenoviral vector-mediated GLIPR1 gene therap (AdGLIPR1) with radiotherapy may achieve additive or synergistic tumor control in selected prostate and bladder tumors.
23333597 GLIPR1 interacts with Hsc70, and GLIPR1 overexpression or Hsc70 knockdown leads to transcriptional suppression of AURKA and TPX2.
22025562 Data show that the expression of GLIPR1 and c-Myc were inversely correlated in prostate cancer.
21931216 GLIPR1 core structure has a conserved central cavity via which CAP proteins are likely to bind to shared ligands.
21922325 demonstrate that GLIPR1 is a methylation-silenced gene in the acute myeloid leukemia patients
21777672 RTVP-1 plays a role in the effect of serum response factor on glioma cell migration
21045302 X-ray data have been collected to beyond 1.9 A resolution from a crystal of GLIPR1 that belonged to the orthorhombic space group P2(1)2(1)2 with average unit-cell parameters a = 85.1, b = 79.5, c = 38.9 A and either a monomer or dimer
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20356381 Induction of GliPR expression by HIV-1 was confirmed in P4-CCR5 cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19483285 GLIPR1 expression is downregulated or even lost by promoter methylation in acute myeloid leukemia.
18199537 GLIPR1 is a proapoptotic tumor suppressor acting through the ROS-JNK pathway.
18030365 a role for GLIPR1/RTVP-1 deregulation early in Wilms tumorigenesis.
17825796 RTVP-1b is a novel splice variant of human RTVP-1, which was isolated from the U87 glioma cell line
16714093 In this study we report the identification and characterization of a novel p53 target gene cluster that includes human RTVP1 (hRTVP-1) together with two GLIPR1L genes (GLIPR1L1 and GLIPR1L2) on human chromosome 12q21 and mouse Rtvp1
14871827 Expression of the human RTVP-1 gene is down-regulated in human prostate cancer specimens compared with normal human prostate tissue at the mRNA and protein levels.

AA Sequence

MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKA      1 - 70
WASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQ     71 - 140
VVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQ    141 - 210
RDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD                  211 - 266
//

Text Mined References (31)

PMID Year Title
26988096 2016 GLI pathogenesis-related 1 functions as a tumor-suppressor in lung cancer.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26267319 2015 RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop.
24008279 2013 Endoplasmic reticulum protein GliPR1 regulates G protein signaling and the cell cycle and is overexpressed in AML.
23714687 2013 MicroRNA-137 is downregulated in glioblastoma and inhibits the stemness of glioma stem cells by targeting RTVP-1.
23433894 2014 Combined therapeutic effects of adenoviral vector-mediated GLIPR1 gene therapy and radiotherapy in prostate and bladder cancer models.
23333597 2013 Glioma pathogenesis-related protein 1 induces prostate cancer cell death through Hsc70-mediated suppression of AURKA and TPX2.
22025562 2011 GLIPR1 suppresses prostate cancer development through targeted oncoprotein destruction.
21931216 2011 Structural studies of human glioma pathogenesis-related protein 1.
21922325 2011 Identification of GLIPR1 tumor suppressor as methylation-silenced gene in acute myeloid leukemia by microarray analysis.
21777672 2011 RTVP-1 expression is regulated by SRF downstream of protein kinase C and contributes to the effect of SRF on glioma cell migration.
21045302 2010 Expression, purification, crystallization and preliminary X-ray analysis of a truncated soluble domain of human glioma pathogenesis-related protein 1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20356381 2010 Inhibition of HIV-1 replication by small interfering RNAs directed against glioma pathogenesis related protein (GliPR) expression.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19483285 2009 [Methylation and expression of glioma pathogenesis-related protein 1 gene in acute myeloid leukemia].
18199537 2008 Glioma pathogenesis-related protein 1 exerts tumor suppressor activities through proapoptotic reactive oxygen species-c-Jun-NH2 kinase signaling.
18030365 2007 Hypomethylation and aberrant expression of the glioma pathogenesis-related 1 gene in Wilms tumors.
17825796 2007 Cloning and characterization of human RTVP-1b, a novel splice variant of RTVP-1 in glioma cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16714093 2006 Identification and characterization of RTVP1/GLIPR1-like genes, a novel p53 target gene cluster.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14871827 2004 RTVP-1, a tumor suppressor inactivated by methylation in prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971968 2002 mRTVP-1, a novel p53 target gene with proapoptotic activities.
9482873 1998 Structure comparison of human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein P14a indicates a functional link between the human immune system and a plant defense system.
8973356 1996 RTVP-1, a novel human gene with sequence similarity to genes of diverse species, is expressed in tumor cell lines of glial but not neuronal origin.
7607567 1995 The human glioma pathogenesis-related protein is structurally related to plant pathogenesis-related proteins and its gene is expressed specifically in brain tumors.