Property Summary

NCBI Gene PubMed Count 112
PubMed Score 325.15
PubTator Score 2335.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease 1.300 3.1e-03
ependymoma 2.300 5.9e-10
osteosarcoma 2.912 1.7e-05
sonic hedgehog group medulloblastoma 3.700 9.4e-08
atypical teratoid / rhabdoid tumor 2.000 1.5e-02
glioblastoma 2.000 2.2e-03
medulloblastoma, large-cell 1.300 1.0e-02
primitive neuroectodermal tumor 2.500 7.6e-03
Atopic dermatitis -1.100 1.3e-03
primary pancreatic ductal adenocarcinoma 1.258 1.2e-03
pediatric high grade glioma 1.600 6.1e-04
pancreatic cancer 1.100 7.8e-03
psoriasis -1.600 2.8e-73

Gene RIF (92)

PMID Text
26896768 ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner in hepatocellular cancer.
26769961 GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization.
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26290144 The results do not support our hypothesis that common germline genetic variants in the GLI2 genes is associated with the risk of developing medulloblastoma.
26261006 Identify mutations that increase GLI activity in patients with Hirschsprung disease.
26238143 Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression
26182949 Serum starvation significantly up-regulated the expression of Gli1, which in turn increased its key target cIAP2 expression and enhanced NF-kappaB/cIAP2 pathway, resulting in promoting cell survival under serum starvation
25974718 GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly.
25964059 hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1
25889765 GLI2 forms part of a core HH pathway transcriptional regulatory network that promotes human myeloid leukemic progression and dormant LSC generation
25888497 Data suggest that hedgehog (HH) signaling through transcription factors GLI1 and GLI2 could be required for the maintenance of pregnancy.
25878059 A relatively high frequency of GLI2 mutations occur in patients with congenital growth hormone deficiency. [Review]
25820550 This family confirms the incomplete penetrance of genomic disturbances affecting the GLI2 gene. However, the family presented here is unique as none of the three identified individuals with a GLI2 deletion showed any typical signs of holoprosencephaly
25807524 the JQ1-resistant cells remain dependent on c-MYC that now becomes co-regulated by high levels of GLI2
25745035 GLI1/2 expression is a negative prognostic factor and might represent a novel druggable target in acute myeloid leukemia.
25715918 during vertebrate history GLI2 acquired a high level of complexity in the genetic mechanisms regulating its expression during spatiotemporal patterning of the central nervous system (CNS) and limbs.
25694126 miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process
25670079 The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-beta-mediated cancer progression
25535898 Gli2 silencing enhances TRAIL-induced apoptosis and reduces tumor growth in human hepatoma cells in vivo.
25449781 Increased GLI2 expression is associated with osteosarcoma invasion.
25359619 High Gli2 expression is associated with bone destruction in lung and breast cancer.
25204354 SPOP plays critical roles in suppressing gastric tumorigenesis through inhibiting Hh/Gli2 signaling pathway. It may provide an alternative strategy for developing therapeutic agents of gastric cancer in future.
25156120 results indicate that miR-202 acts as a novel tumor suppressor to regulate OS cell proliferation and apoptosis through downregulating Gli2 expression.
25132524 Findings indicate that Gli2 overexpression in PCa cells might support development of castration resistant PCa through AR co-activation and suggests that AR might modulate transcription from Gli2.
25085524 Report shows that GLI2 is the novel target gene of DeltaNp63alpha and that DeltaNp63alpha-GLI2 crosstalk in osteosarcoma cells is a necessary event in osteosarcoma progression.
25082385 GLI2 regulated metastasis as well as the progression of osteosarcomas.
24744436 Individuals with truncating mutations in GLI2 typically present with pituitary anomalies, polydactyly and subtle facial features rather than holoprosencephaly
24481442 GLI2 induces genomic instability in human keratinocytes by inhibiting apoptosis.
24423612 Our studies demonstrate an important role for GLI2 in Lung squamous cell carcinoma
24418624 we demonstrate that similarly to Ulk3 RNAi, SU6668 prevents de novo expression of Gli1/2 proteins and antagonizes the Gli-dependent activation of the gene expression programs induced by either Shh or TGF-b.
24058673 The transcription factors GLI1 and GLI2 activate the SOCS1 promoter, which contains five putative GLI binding sites, and GLI2 binding to the promoter was shown by chromatin immunoprecipitation.
23890107 GLI2 represses E-cadherin gene (CDH1) expression in melanoma cells via distinct mechanisms, enhancing transcription of the EMT-activator ZEB1.
23792444 our results show that GLI1 and GLI2 facilitate the propagation of cells with damaged DNA
23762415 Gli2 acetylation at lysine 757 regulates hedgehog-dependent transcriptional output by preventing its promoter occupancy.
23493353 Data indicate that Shh, Ptch1, Gli1, and Gli2 mRNA expressions were markedly increased in intrahepatic cholangiocellular carcinoma (ICC).
23442119 No deletion or amplification of the entire GLI2 gene was found in a group of patients with isolated or syndrome-associated esophageal atresia.
23408573 We show that heterozygous amino acid substitutions within GLI2 may lead to multiple piutitary hormone deficiency with mild extrapituitary findings.
23371028 GLI2 was correlated with lymphovascular invasion and intestinal type gastric cancer.
23356443 high expression level of Gli2 was significantly associated with tumor differentiation, encapsulation, vascular invasion, early recurrence, and intra-hepatic metastasis in hepatocellular carcinoma.
23304807 Mutations in GLI2 have been found in association with holoprosencephaly (HPE) and HPE-like phenotype, with and without pituitary hormone deficiencies; as well as in patients with pituitary dysfunction with and without HPE craniofacial features.
23208494 THE MEK-RSK cascade positively regulates GLI2 stabilization and represses its degradation via inhibiting GSK-3beta-dependent phosphorylation and ubiquitination of GLI2.
23178452 Overexpression of MAP3K10 resulted in upregulation of Gli-1 and Gli-2 in pancreatic ductal adenocarcinoma cells.
22967285 A relatively high frequency of non-synonymous GLI2 variants was identified in patients with congenital growth hormone deficiency and combined pituitary hormone deficiency without other brain defects.
22925276 We genotyped the SLC6A4 5-HTTLPR (rs4795541, rs25531) and TPH2 1125A>T (rs4290270) variants and evaluated their role in moderating disulfiram treatment for cocaine dependence.
22859956 Transcriptional regulation of TGF-beta1 by GLI2 is a new extension to Sonic Hedgehog and TGF-beta1 cross-regulation.
22859956 HIV-1 Tat binds to GLI2 and GLI2 binds to the human TGFB1 promoter, suggesting a potential mechanism for TGFB1 induction in HIV-1 infection
22535603 The immunoexpression of Shh, Smo and Gli2 proteins was lower in Helicobacter pylori-positive group compared to Helicobacter pylori-negative group
22496449 identified a GLI2 binding site within the -334/-296 region of the M-MITF promoter, critical for GLI2-driven transcriptional repression
22395235 Gli2 expression in HL60 and U937 cells induced by TGF-beta is Smad3-dependent and independent of Hh receptor signaling.
22040957 Gli1 and Gli2 are highly expressed in in non-Hodgkin's lymphoma. Expression positively correlated to clinical staging of NHL.
21862631 This short review summarizes recent knowledge about GLI2 function and mechanisms of action downstream of TGF-beta in cancer.[Review]
21801332 These findings thus identify GLI2 as a critical transcription factor antagonizing M-MITF function to promote melanoma cell phenotypic plasticity and invasive behavior.
21695716 data suggest that Gli2 plays a predominant role in the proliferation and apoptosis resistance of HCC cells, and that knockdown of Gli2 may be a novel anticancer strategy for the treatment of HCC
21454528 CCL5 signaling induces GLI2 through a PI3K-AKT-IkappaBalpha-p65 pathway and requires GLI2 transcriptional activity to modulate IL-6 expression and Ig secretion in vitro and in vivo
21204792 Novel sequence variants were found in the GLI2 gene in patients with marked involvement of the temporomandibular joint, a new clinical finding observed with mutations of this gene.
21095584 A fragment of the Hh-responsive GLI2 transcription factor directly binds and inhibits the p16 promoter and senescence is associated with the loss of nuclear GLI2.
20939080 our findings support a possible contribution of GLI2 to tardive dyskinesia susceptibility.
20939080 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20712011 In human hepatocellular, the hedgehog signaling pathway is involved in the differentiation and proliferation of tumor cells, in part through inducing nuclear accumulation of Gli2 protein and subsequent upregulation of FoxM1 protein.
20685856 These phenotypes support partial penetrance, variable polydactyly, midline facial defects, and pituitary hormone deficiencies, including diabetes insipidus, conferred by heterozygous frameshift or nonsense GLI2 mutations.
20660365 In human melanoma cells, GLI2 expression was heterogeneous, associated with loss of E-cadherin and increased in the most aggressive tumors. In this preclinical study, GLI2 was directly involved in driving melanoma invasion and metastasis.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20488474 The invasiveness of human bladder TCC lines strongly correlated with expression of Gli2, a downstream mediator of Hh signaling.
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20420697 The finding that Gli2 co-immunoprecipitates with androgen receptor protein suggests that an interaction between these proteins might be the basis for Hedgehog/Gli support of androgen signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20146882 Expression of SHH, GLI family zinc finger 2 (GLI2) and BMP4 mRNA and protein in the posterior wall of the terminal rectum in 40 patients with orectal malformations, were assessed.
20099029 Constitutive expression of the human hGli2 Delta N in porcine keratinocytes causes cutaneous changes not seen in the murine model. A multiple species animal model approach is needed to understand the role of Gli2 in mammalian skin.
19996099 Data suggest a novel mechanism in which PKA down-regulates Hedgehog signaling by promoting the interaction between 14-3-3 and Gli as well as proteolysis.
19937600 Observational study of gene-disease association. (HuGE Navigator)
19593328 Sonic hedgehog protein, GLI1-3 and ATP-binding cassette G2 are aberrantly expressed in diffuse large B-cell lymphoma.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19432668 Gli-2 rather than Gli-1 may play a pivotal role in Hedgehog signaling of endometrial carcinoma.
19015636 The stroma, in a tissue-specific manner, determines whether certain GLI2 oncogenic traits are expressed.
18794086 increased levels of GLI2 correlates with AI progression
18319260 These results reveal a key role of GLI2 in activation of the activin/BMP antagonist FST in response to hedgehog (HH) signaling.
18264131 Since Gli2 silencing not only downregulates cFlip, but also Bcl-2, Gli2 could be a key target for a novel therapeutic approach in basal cell carcinoma.
18006803 GLI2 plays a critical role in the malignant phenotype of prostate cancer cells
17638910 transforming growth factor-beta has a role in Smad3-dependent activation of Gli2 and Gli1 expression
16953426 Observational study of gene-disease association. (HuGE Navigator)
16651270 beta-TrCP2 is a pivotal regulator of Gli2 expression and there may be an important role for posttranslational modulation of GLI2 protein levels in Hh pathway-associated human prostate cancer
16553965 Alternative splicing may be another important regulatory mechanism for the modulation of repressor and activator properties of GLI2 protein.
16434164 Upregulation of largely overlapping sets of target genes was effected by both factors,GLI1 and GLI2, repression occurred predominantly in response to GLI2.
16327884 Observational study of gene-disease association. (HuGE Navigator)
16192985 Higher levels of TPH2 mRNA were found throughout the entire extent of the rostrocaudal axis of the median raphe nuclei in major depression and suicide.
15994174 Our results establish the presence of an amino-terminal transcriptional repressor domain that plays a critical role in modulating the function of wild-type GLI2 and is essential for dominant-negative activity of a GLI2 mutant associated with human disease
15175043 important role for GLI2 in regulating epidermal proliferation and skin tumorigenesis.
14691458 GLI2 expression in human keratinocytes results in a marked downregulation of epidermal differentiation markers.
14581620 GLI2 has a role in defective anterior pituitary formation and pan-hypopituitarism, and in human head development
11160734 HIV-1 Tat binds to GLI2 and GLI2 binds to the human TGFB1 promoter, suggesting a potential mechanism for TGFB1 induction in HIV-1 infection

AA Sequence

METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHAPLPIDMRHQE      1 - 70
GRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHPYVNPHMEHYLRSVHSSPTLS     71 - 140
MISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQMTLVAGHPAPYGDLLMQSGGAASAPHLHDYL    141 - 210
NPVDVSRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGA    211 - 280
LSPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSD    281 - 350
TNQNKQSSESAVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED    351 - 420
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYML    421 - 490
VVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN    491 - 560
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEA    561 - 630
SSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDT    631 - 700
PPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILEN    701 - 770
FSGSGGGGPAGLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP    771 - 840
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLER    841 - 910
MSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGARRASDPVRRPDALS    911 - 980
LPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLARGAYSPRPPSISENVAMEAVAAGVDGAGPE    981 - 1050
ADLGLPEDDLVLPDDVVQYIKAHASGALDEGTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPS   1051 - 1120
APMLGGCQLGFGAPSSLNKNNMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQG   1121 - 1190
LQASPGGLDSTQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS   1191 - 1260
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQSYPQQSHHLAA   1261 - 1330
SMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPTGRHRGVRAVQQQLAYARATG   1331 - 1400
HAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAPDHSMLYYYGQIHMYEQDGGLENLGSCQVMR   1401 - 1470
SQPPQPQACQDSIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQN   1471 - 1540
SSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT                           1541 - 1586
//

Text Mined References (118)

PMID Year Title
26896768 2016 Aldehyde dehydrogenase 1A1 stabilizes transcription factor Gli2 and enhances the activity of Hedgehog signaling in hepatocellular cancer.
26769961 2016 Glioma-associated Oncogene 2 Is Essential for Trophoblastic Fusion by Forming a Transcriptional Complex with Glial Cell Missing-a.
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26261006 2015 Identification of GLI Mutations in Patients With Hirschsprung Disease That Disrupt Enteric Nervous System Development in Mice.
26238143 2015 Effect of Rab23 on the proliferation and apoptosis in breast cancer.
26182949 2015 Up-Regulation of Glioma-Associated Oncogene Homolog 1 Expression by Serum Starvation Promotes Cell Survival in ER-Positive Breast Cancer Cells.
25974718 2015 GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly.
25964059 2015 Screening of differential microRNA expression in gastric signet ring cell carcinoma and gastric adenocarcinoma and target gene prediction.
25889765 2015 GLI2 inhibition abrogates human leukemia stem cell dormancy.
25888497 2015 Hedgehog signaling through GLI1 and GLI2 is required for epithelial-mesenchymal transition in human trophoblasts.
25878059 2015 Role of GLI2 in hypopituitarism phenotype.
25820550 2015 A familial GLI2 deletion (2q14.2) not associated with the holoprosencephaly syndrome phenotype.
25807524 2015 GLI2-dependent c-MYC upregulation mediates resistance of pancreatic cancer cells to the BET bromodomain inhibitor JQ1.
25745035 2015 Expression of Hedgehog Pathway Mediator GLI Represents a Negative Prognostic Marker in Human Acute Myeloid Leukemia and Its Inhibition Exerts Antileukemic Effects.
25715918 2015 Cis-regulatory control of human GLI2 expression in the developing neural tube and limb bud.
25694126 2015 Thermo-chemotherapy Induced miR-218 upregulation inhibits the invasion of gastric cancer via targeting Gli2 and E-cadherin.
25670079 2015 14-3-3? turns TGF-?'s function from tumor suppressor to metastasis promoter in breast cancer by contextual changes of Smad partners from p53 to Gli2.
25535898 2014 Gli2 silencing enhances TRAIL-induced apoptosis and reduces tumor growth in human hepatoma cells in vivo.
25449781 2015 Ribosomal protein S3 regulates GLI2-mediated osteosarcoma invasion.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25359619 2014 Wnt signaling induces gene expression of factors associated with bone destruction in lung and breast cancer.
25204354 2014 SPOP suppresses tumorigenesis by regulating Hedgehog/Gli2 signaling pathway in gastric cancer.
25156120 2014 miR-202 suppresses proliferation and induces apoptosis of osteosarcoma cells by downregulating Gli2.
25132524 2014 Determinants of Gli2 co-activation of wildtype and naturally truncated androgen receptors.
25085524 2014 ?Np63? enhances the oncogenic phenotype of osteosarcoma cells by inducing the expression of GLI2.
25082385 2015 GLI2 is a novel therapeutic target for metastasis of osteosarcoma.
24744436 2014 Pathogenic mutations in GLI2 cause a specific phenotype that is distinct from holoprosencephaly.
24481442 2014 GLI2 induces genomic instability in human keratinocytes by inhibiting apoptosis.
24423612 2014 Hedgehog-GLI signaling inhibition suppresses tumor growth in squamous lung cancer.
24418624 2014 Protein kinase inhibitor SU6668 attenuates positive regulation of Gli proteins in cancer and multipotent progenitor cells.
24311597 2013 Structural basis of SUFU-GLI interaction in human Hedgehog signalling regulation.
24058673 2013 Hedgehog/GLI signaling activates suppressor of cytokine signaling 1 (SOCS1) in epidermal and neural tumor cells.
23890107 2013 GLI2 cooperates with ZEB1 for transcriptional repression of CDH1 expression in human melanoma cells.
23792444 2014 The oncogenic GLI transcription factors facilitate keratinocyte survival and transformation upon exposure to genotoxic agents.
23762415 2013 Gli2 acetylation at lysine 757 regulates hedgehog-dependent transcriptional output by preventing its promoter occupancy.
23493353 2013 The prognostic significance and therapeutic potential of hedgehog signaling in intrahepatic cholangiocellular carcinoma.
23442119 Normal exon copy number of the GLI2 and GLI3 genes in patients with esophageal atresia.
23408573 2013 Functional characterization of a heterozygous GLI2 missense mutation in patients with multiple pituitary hormone deficiency.
23371028 2013 Gastric cancer (GC) patients with hedgehog pathway activation: PTCH1 and GLI2 as independent prognostic factors.
23356443 2013 Expression of glioma-associated oncogene 2 (Gli 2) is correlated with poor prognosis in patients with hepatocellular carcinoma undergoing hepatectomy.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23304807 2012 GLI2 mutations as a cause of hypopituitarism.
23208494 2014 MEK1-RSK2 contributes to Hedgehog signaling by stabilizing GLI2 transcription factor and inhibiting ubiquitination.
23178452 2013 MAP3K10 promotes the proliferation and decreases the sensitivity of pancreatic cancer cells to gemcitabine by upregulating Gli-1 and Gli-2.
22967285 2013 Relatively high frequency of non-synonymous GLI2 variants in patients with congenital hypopituitarism without holoprosencephaly.
22925276 2012 Modifying the role of serotonergic 5-HTTLPR and TPH2 variants on disulfiram treatment of cocaine addiction: a preliminary study.
22859956 2012 GLI2 regulates TGF-?1 in human CD4+ T cells: implications in cancer and HIV pathogenesis.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22535603 2012 The immunoexpression of Shh, Smo and Gli2 in Helicobacter pylori positive and negative gastric biopsies.
22496449 2012 Expression of microphthalmia-associated transcription factor (MITF), which is critical for melanoma progression, is inhibited by both transcription factor GLI2 and transforming growth factor-?.
22395235 2012 Effect of TGF-? on Gli2 expression in HL60 and U937 cell lines.
22040957 2011 [Expression and clinical significances of hedgehog signaling pathway in non-Hodgkin's lymphoma].
21862631 2011 TGF-?/SMAD/GLI2 signaling axis in cancer progression and metastasis.
21801332 2011 GLI2 and M-MITF transcription factors control exclusive gene expression programs and inversely regulate invasion in human melanoma cells.
21695716 2011 shRNA-mediated silencing of Gli2 gene inhibits proliferation and sensitizes human hepatocellular carcinoma cells towards TRAIL-induced apoptosis.
21454528 2011 GLI2 transcription factor mediates cytokine cross-talk in the tumor microenvironment.
21204792 2012 Clinical findings in patients with GLI2 mutations--phenotypic variability.
21095584 2010 Primary cilium-dependent and -independent Hedgehog signaling inhibits p16(INK4A).
20939080 2010 Evidence for association of the GLI2 gene with tardive dyskinesia in patients with chronic schizophrenia.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20712011 2010 Nuclear accumulation of glioma-associated oncogene 2 protein and enhanced expression of forkhead-box transcription factor M1 protein in human hepatocellular carcinoma.
20685856 2010 Novel heterozygous nonsense GLI2 mutations in patients with hypopituitarism and ectopic posterior pituitary lobe without holoprosencephaly.
20660365 2010 GLI2-mediated melanoma invasion and metastasis.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20488474 2010 Gli2 expression and human bladder transitional carcinoma cell invasiveness.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
20420697 2010 Hedgehog/Gli supports androgen signaling in androgen deprived and androgen independent prostate cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20146882 Down-regulation of SHH/BMP4 signalling in human anorectal malformations.
20099029 2010 Varying phenotypes in swine versus murine transgenic models constitutively expressing the same human Sonic hedgehog transcriptional activator, K5-HGLI2 Delta N.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19996099 2010 Identification of a suppressive mechanism for Hedgehog signaling through a novel interaction of Gli with 14-3-3.
19937600 2010 Testing reported associations of genetic risk factors for oral clefts in a large Irish study population.
19878745 2010 Identification of a novel serine/threonine kinase ULK3 as a positive regulator of Hedgehog pathway.
19593328 2009 Sonic hedgehog signaling proteins and ATP-binding cassette G2 are aberrantly expressed in diffuse large B-cell lymphoma.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19432668 2009 Expression of sonic hedgehog signaling molecules in normal, hyperplastic and carcinomatous endometrium.
19015636 2009 Stromal control of oncogenic traits expressed in response to the overexpression of GLI2, a pleiotropic oncogene.
18794086 2008 GLI2 knockdown using an antisense oligonucleotide induces apoptosis and chemosensitizes cells to paclitaxel in androgen-independent prostate cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18455992 2008 Application of active and kinase-deficient kinome collection for identification of kinases regulating hedgehog signaling.
18319260 2008 GLI2-specific transcriptional activation of the bone morphogenetic protein/activin antagonist follistatin in human epidermal cells.
18264131 2008 Gli2 upregulates cFlip and renders basal cell carcinoma cells resistant to death ligand-mediated apoptosis.
18006803 2007 Role of GLI2 transcription factor in growth and tumorigenicity of prostate cells.
17638910 2007 Induction of sonic hedgehog mediators by transforming growth factor-beta: Smad3-dependent activation of Gli2 and Gli1 expression in vitro and in vivo.
17569090 2007 A new locus for split hand/foot malformation with long bone deficiency (SHFLD) at 2q14.2 identified from a chromosome translocation.
17096318 2006 GLI2 mutations in four Brazilian patients: how wide is the phenotypic spectrum?
16953426 2006 Analysis of candidate genes on chromosome 2 in oral cleft case-parent trios from three populations.
16651270 2006 Gli2 is targeted for ubiquitination and degradation by beta-TrCP ubiquitin ligase.
16553965 2006 A potential role of alternative splicing in the regulation of the transcriptional activity of human GLI2 in gonadal tissues.
16434164 2006 Overlapping and distinct transcriptional regulator properties of the GLI1 and GLI2 oncogenes.
16327884 2005 Medical sequencing of candidate genes for nonsyndromic cleft lip and palate.
16192985 2006 Neuronal tryptophan hydroxylase mRNA expression in the human dorsal and median raphe nuclei: major depression and suicide.
15994174 2005 A previously unidentified amino-terminal domain regulates transcriptional activity of wild-type and disease-associated human GLI2.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15175043 2004 GLI2 is expressed in normal human epidermis and BCC and induces GLI1 expression by binding to its promoter.
14691458 2004 The zinc-finger transcription factor GLI2 antagonizes contact inhibition and differentiation of human epidermal cells.
14581620 2003 Loss-of-function mutations in the human GLI2 gene are associated with pituitary anomalies and holoprosencephaly-like features.
12917489 2003 Indian hedgehog and beta-catenin signaling: role in the sebaceous lineage of normal and neoplastic mammalian epidermis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435627 2002 Ski is involved in transcriptional regulation by the repressor and full-length forms of Gli3.
12165851 2002 Human GLI2 and GLI1 are part of a positive feedback mechanism in Basal Cell Carcinoma.
11238441 2001 Physical and functional interactions between Zic and Gli proteins.
11160734 2001 Human GLI-2 is a tat activation response element-independent Tat cofactor.
10806483 2000 Gli regulation by the opposing activities of fused and suppressor of fused.
10564661 1999 Characterization of the human suppressor of fused, a negative regulator of the zinc-finger transcription factor Gli.
10074179 1999 Interaction of Gli2 with CREB protein on DNA elements in the long terminal repeat of human T-cell leukemia virus type 1 is responsible for transcriptional activation by tax protein.
9731531 1998 Essential function of Gli2 and Gli3 in the formation of lung, trachea and oesophagus.
9557682 1998 Cloning of novel isoforms of the human Gli2 oncogene and their activities to enhance tax-dependent transcription of the human T-cell leukemia virus type 1 genome.
8812445 1996 Assignment of the human GLI2 gene to 2q14 by fluorescence in situ hybridization.
8378770 1993 Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
8350401 1993 A new regulatory element that augments the Tax-dependent enhancer of human T-cell leukemia virus type 1 and cloning of cDNAs encoding its binding proteins.
8150204 1994 Expression of three mouse homologs of the Drosophila segment polarity gene cubitus interruptus, Gli, Gli-2, and Gli-3, in ectoderm- and mesoderm-derived tissues suggests multiple roles during postimplantation development.
2850480 1988 The GLI-Kruppel family of human genes.
2832761 1988 The GLI gene is a member of the Kruppel family of zinc finger proteins.