1. Home
  2. Targets
  3. Zinc finger protein GLI1

Tchem Zinc finger protein GLI1

Isoform 2: Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration.

This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

 Comments

Property Summary

NCBI Gene PubMed Count 258
PubMed Score 942.79
PubTator Score 616.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 5.583 2.8

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 1.5e-05
osteosarcoma 1.720 1.5e-03
atypical teratoid / rhabdoid tumor 1.200 5.6e-04
sonic hedgehog group medulloblastoma 1.500 6.7e-05
psoriasis -1.100 3.5e-27

Synonym

Accession P08151 D0EUY3 E9PQQ9 F5H6H8 Q8TDN9
Symbols GLI

Gene

GLI1

PDB

4BLB   4KMD   2GLI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (20)

See all...

 GO Function (8)

 GO Component (9)

 GO Process (27)

See all...

 Compartment GO Term (35)

See all...

 MGI Phenotype (14)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (21)

See all...

Protein-protein Interaction (15)

UBB   UBC   PRKACA   PRKACG   PRKACB   NUMB   RBX1   RPS27A   UBA52   SKP1   CUL1   CDC73   ULK3   ITCH   SUFU  

Ligand (2)

Structure of CHEMBL1215434

CHEMBL1215434
pIC50 6.18

Structure of CHEMBL504404

CHEMBL504404
pIC50 6.21

Gene RIF (229)

PMID Text
26997450 Increased SHH, PTCH, and GLI1 protein correlated positively with tumor grade, tumor depth and lymph node metastasis in Peutz-Jeghers syndrome.
26945969 low expression of PCAF in hepatocellular carcinoma tissues facilitates tumor cells migration and invasion which is achieved via Gli1-driven epithelial-mesenchymal transition phenotypes.
26718507 TRIM16 directly regulated the degradation of Gli1 protein via the ubiquitinproteasome pathway.
26603838 IKK-beta suppresses GLI1 ubiquitination.
26601952 NFATc1binds the GLI1 promoter and represses its transcription.
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26544916 GLI1 may be a biomarker of poor prognosis in rhabdomyosarcoma patients, and could itself be a therapeutic target
26505381 The study demonstrates increased expression of Gli1 and p53 in PDAC, and proves that Gli1 could be apotential biomarker for prognostic judgment.
26465952 Data indicate that regulation of sonic hedgehog (SHh)-GLI family zinc finger 1 (Gli1) signals to migration of pancreatic cancer AsPC-1 Cells through mediating eukaryotic translation initiation factor 5A (EIF5A2) gene expression.
26413813 Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement.
26349604 GLI1 expression in both H441 and PW cells was associated with increased expression of NDRG1, a gene known to be downregulated by the MYC family of proteins, indicating that upregulation of NDRG1 by GLI1 is not cell-type specific.
26317501 Study shows that overexpression of SHH and Gli1 correlates with an increased risk along with a poor Myelodysplastic Syndrome prognosis.
26282181 findings suggest that p53 sequesters TAF9 from GLI1, which may contribute to inhibition of GLI1 activity by p53
26276718 Aberrant activation of SHH-GLI signaling promotes upregulation of ABCG2 that plays key roles in the development of drug resistance.
26261006 Identify mutations that increase GLI activity in patients with Hirschsprung disease.
26238143 Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression
26219678 High GLI1 expression is associated with pituitary adenomas.
26218750 These results suggest a linkage between Cul4A and Gli1 expression in human mesothelioma.
26212257 Data indicate that resveratrol plus curcumin inhibits Hedgehog-Gli1 components in p21Waf1/Cip1 dependent manner.
26107686 clearly related to aggressive clinicopathological features of papillary thyroid cancers
26093087 Immunohistochemical analysis of 122 gliomas showed that TGLI1 expression was positively correlated with VEGF-C, TEM7 and microvessel density.
26085085 Depletion of IPO7 by IPO7 siRNA reduced nuclear accumulation of GLI1. In addition, FOXM1 induced nuclear import of GLI1 by promoting IPO7 expression.
25915429 Hhemotherapy-induced catabolism in healthy fibroblasts constitutes a source of energy-rich nutrients and inflammatory cytokines which could activate hedgehog/GLI signaling in breast cancer cells.
25888497 Data suggest that hedgehog (HH) signaling through transcription factors GLI1 and GLI2 could be required for the maintenance of pregnancy.
25855960 Results show that PCAF can induce cell apoptosis by modulating a GLI1/Bcl-2/BAX axis that in turn suppresses HCC progression.
25775002 single continuous distribution pattern of GLI1 mRNA expression technically puts almost all GBM patients in a single group rather than discrete high- or low-clusters in terms of Hh-pathway activity
25745035 GLI1/2 expression is a negative prognostic factor and might represent a novel druggable target in acute myeloid leukemia.
25686837 CtBP2 may serve as a prognostic marker for post liver resection HCC and may play a role during GLI1-driven EMT as a transcriptional co-repressor of SNAI1.
25667444 GLI1, NOTCH1 and CTNNB1 expression were assayed in a tissue microarray of 68 TET and eight benign thymus by fluorescent immunohistochemistry (AQUA) as surrogates for activity of the sonic hedgehog, NOTCH and WNT pathways
25639866 show that combined targeting of GLI and PI3K/AKT/mTOR signaling can have a synergistic therapeutic effect in cells from a subgroup of chronic lymphocytic leukemia patients
25588831 These data suggest that GLI interactions with KIF3A-KIF3B-KAP3 complexes are essential for proper GLI transcriptional activity.
25586417 The results of the current study suggest that Gli1 regulates TGFbeta1induced EMT, which may provide a novel therapeutic target to inhibit metastasis in patients with NSCLC.
25552484 Shh and Gli1 are prognostic biomarkers for patients with resected PDAC.
25501705 These data indicate that Gil-1 is crucial for hypoxia-induced EMT and invasion of breast cancer cells and may be a therapeutic target for intervention of breast cancer metastasis.
25432698 These findings revealed a novel role for Shh-Gli1 signals in epithelial-mesenchymal transition in ovarian cancer
25422081 Over-expressed CK2alpha positively regulate Hh/Gli1 signaling in human mesothelioma.
25373737 Sufu has a role in repressing Gli1 transcription and nuclear accumulation, inhibiting glioma cell proliferation, invasion and vasculogenic mimicry, improving glioma chemo-sensitivity and prognosis
25352360 GLI1 Q1100E polymorphism was closely associated with chronic lymphocytic leukemia.
25350271 GLI1 may play a role in BCC pathogenesis through its role in cell proliferation, migration, and angiogenesis
25253693 Gli1 has a role in regulating the S-phase checkpoint in tumor cells via Bid protein, and its inhibition sensitizes to DNA topoisomerase 1 inhibitors
25252859 GLI1 is important for the maintenance of characteristics of metastatic breast cancer stem cells.
25166306 Results showed that MUC5AC expression is correlated to the tumor stage where advanced gastric cancers present reduced levels of MUC5AC and that Gli regulates its expression via interaction with a highly conserved sequence in its promoter region.
25141859 High Gli1 expression is associated with visceral pleural invasion and lymphatic thromboembolism in non-small-cell lung cancer.
25134527 Results demonstrate that the impact of S6K1 kinase on neuroblastoma cells is not mediated through modulation of GLI1 expression an the effects of S6K1 and GLI1 signaling on neuroblastoma cell proliferation are mediated through independent mechanisms.
25120849 these results indicate that the high-expression levels of Gli1 and Wnt2B might play a pivotal role during tumorigenesis of pancreatic cancer
25103784 High expression of GLI1 mRNA was associated with advanced lung adenocarcinoma.
25060182 The expression of Shh/Gli-1 was significantly associated with papillary thyroid carcinoma tumor size, clinical staging, and lymph node metastasis
25027328 Ptc1-Gli1 signaling deregulation resulting in abnormal loss of glial precursor cells may contribute to a cognition decline in Alzheimer's disease brains.
25024229 a new mechanism of Gli transcription factor activation and implicate ARHGAP36 dysregulation in the onset and/or progression of GLI-dependent cancers.
25017332 The negative regulation of glioma-associated oncogene 1 (Gli1), an important downstream effector of Hh, by the AMPK signal transduction pathway, is reported.
24926795 Results suggest that Gli1 may play a strong role in modulating total cellular accumulation of cisplatin in ovarian cancer cells, through altered drug uptake and altered drug efflux.
24889938 Estrogen acts via Gli1 to promote cancer stem cell development and epithelial-mesenchymal transition in estrogen receptors-positive breast cancer cells.
24870236 GLI1 alone is sufficient to drive UGT1A-dependent glucuronidation of ribavirin and Ara-C, and thus drug resistance
24856810 Gli1 expression may be a marker of low-stage, low-grade bladder tumors and an indicator of a reduced risk of recurrence
24854174 Data suggest nuclear entry of Gli1 (glioma-associated oncogene homolog, a zinc finger protein) is regulated by unique mechanism via mutually exclusive binding by its nuclear import factor Impbeta1 (importin beta1) and SuFu (suppressor of fused protein).
24792036 our results suggest that down-regulation of Gli-1 suppresses HCC cell migration and invasion likely through inhibiting expressions and activations of MMP-2, 9 and blocking EMT.
24758269 Gli1 expression is reversely associated with the expression of epithelial-mesenchymal transition markers E-Cadherin and beta-Catenin in lung squamous cell carcinoma specimens.
24739390 These results define a novel epigenetic mechanism that uses the transcription factor GLI1 and its associated complex as a central effector to regulate gene expression in cancer cells.
24733827 The expression of GLi1 in 50 human cholangiocellular carcinoma, cholangiocarcinoma cell line, and vivo growing tumors was measured by quantitative PCR
24726458 The data demonstrate the existence of a novel non-coding RNA-based negative feedback loop controlling GLI1 levels.
24710823 High Gli-1 expression is associated with lymph node metastasis in non-small cell lung cancers.
24706306 The glioma-associated oncogene 1 is a target of the miR-324-5p.
24678763 AsO induced HCC CSC differentiation, inhibited recurrence, and prolonged survival after hepatectomy by targeting GLI1expression.
24573955 Expression of Gli1 and alphavbeta6 inversely correlates in tumours in vivo, and Hh targeting up-regulates TGF-beta1/Smad2/3-dependent alphavbeta6 expression, promoting pro-tumourigenic cell functions in vitro.
24470513 This is the first study identifying GLI1 rs2228226 G>C as an independent prognostic marker in patients with stage II and III colon carcinoma.
24454730 GLI1 may be attributed to Cav-1 up-regulation which plays an important role in GLI1-driven epithelial-mesenchymal transition phenotype in hepatocellular carcinoma.
24418624 we demonstrate that similarly to Ulk3 RNAi, SU6668 prevents de novo expression of Gli1/2 proteins and antagonizes the Gli-dependent activation of the gene expression programs induced by either Shh or TGF-b.
24393846 observed a physical association between Wwox and the Gli1 zinc-finger transcription factor involved in the hedgehog pathway
24393163 signaling mediated by Smo contributes to acquired chemoresistance through activating the transcriptional factor Gli
24384722 Gli1 inhibited cell growth, cell cycle progression and induced apoptosis and autophagy depending on ERK1/2 activity in chondrosarcoma cells.
24366538 Southwestern blot assay, EMSA and ChIP assays indicate that only one of five isoforms of GLI1 may be responsible for the Hedgehog link with C-JUN and thus, increased platinum-DNA adduct repair
24357514 result showed that microRNA218 targeted directly the N terminus of GLI1 molecular, and repressed the GLI1 expression in U87MG cells
24311597 It is demonstrated that GLI binding is associated with major conformational changes in SUFU, including an intrinsically disordered loop that is also crucial for pathway activation.
24289472 Overexpression of Gli1, MDM2 and mutant p53 contributes to the development and progression of pancreatic cancer (PC), and plays an important role in predicting PC patients' prognosis.
24223768 GLI1, the primary Hedgehog target, is a potential driver in human papillomavirus 2 head and neck squamous cell carcinoma.
24217340 The 'closed' form of Sufu is stabilized by Gli binding and inhibited by Hh treatment, whereas the 'open' state of Sufu is promoted by Gli-dissociation and Hh signaling.
24165159 GLI1 expression was immunohistochemically related positively with BHLHE41 and inversely with MLH1 in PDAC cells and precancerous lesions of the pancreas.
24081672 Gli-1 expression increased markedly, and was closely associated with increased Snail expression and decreased E-cadherin expression
24076122 These findings have implications for understanding the cellular functions of Fem1b, and the regulation of Gli1 oncoprotein activity.
24072710 Dzip1-dependent stabilization of Spop/HIB is evolutionarily conserved and essential for proper regulation of Gli/Ci proteins in the Hh pathway.
24058673 The transcription factors GLI1 and GLI2 activate the SOCS1 promoter, which contains five putative GLI binding sites, and GLI2 binding to the promoter was shown by chromatin immunoprecipitation.
24045042 TGLI1 is a splice variant of GLI1 that promotes glioblastoma angiogenesis and growth
24013724 These data unveil a p53/PCAF/Gli1 circuitry centered on PCAF that limits Gli1-enhanced mitogenic and prosurvival response.
23936094 The transcriptional factor Gli1 was a target of miR-202-3p and plays an essential role as a mediator of the biological effects of miR-202-3p in gastric cancer.
23900341 Findings suggest an important role of Gli1 as a tumor suppressor in neuroblastoma, and offer a mechanism by which AKT2 regulates the subcellular localization, and in turn, inhibits the tumor-suppressive function of Gli1 in neuroblastoma.
23860225 Nuclear expression of Gli1 or NF-kappaB(RelA) is a strong predictor of poor prognosis in pancreatic cancer.
23792444 our results show that GLI1 and GLI2 facilitate the propagation of cells with damaged DNA
23791879 Gli1-targeting siRNA could induce growth inhibition and apoptosis in PC through knockdown of Gli1 and its target genes.
23788111 Down-expression of Snail reversed GLI1 activation-regulated expression of epithelial--mesenchymal transition markers.
23757299 This enhanced cell invasive effect was reversed by a GLI-1-specific inhibitor in vitro.
23686308 Data suggest that blocking Gli transactivation, an important control point of multiple oncogenic pathways, may be an effective anticancer strategy.
23667589 While autonomous Gli activity controls non-small cell lung cancer (NSCLC) proliferation, increased Shh expression by NSCLC is associated with fibroblast activation in tumor-associated stroma.
23645762 High GLI1 expression is associated with intrahepatic cholangiocarcinoma.
23580656 GLI1 contributes to the survival of diffuse large B-cell lymphoma (DLBCL) cells and that this effect occurs in part through promotion of the transcription of AKT genes.
23555905 Clinical data support the role of Gli1 as a prognostic marker in advanced serous ovarian cancer and as a possible therapeutic target in this disease.
23525267 c-MYC directly regulates GLI1 and support an antiapoptotic role for GLI1 in Burkitt lymphoma.
23520544 Gli1 deletion prevents Helicobacter-induced gastric metaplasia and expansion of myeloid cell subsets.
23493353 Data indicate that Shh, Ptch1, Gli1, and Gli2 mRNA expressions were markedly increased in intrahepatic cholangiocellular carcinoma (ICC).
23446420 aPKC-iota/lambda functions downstream of smoothened to phosphorylate and activate GLI1, resulting in maximal DNA binding and transcriptional activation
23436775 GLI1 regulates the neuropilin-2/alpha6beta1 integrin based autocrine pathway that contributes to breast cancer initiation.
23395608 Results indicate that overexpression of VHL may antagonize Hedgehog-Gli activation at the post-translational level in Hedgehog pathway-induced cancers.
23337877 A novel regulatory loop has been described between GLI1 and Kindlin-2 that determines cancer cell viability.
23336661 Shh, Gli1, VEGFC, and VEGFR3 expression was higher in colorectal adenocarcinoma than in normal mucosa. Shh expression was not associated with Gli1 expression. Gli1 expression correlated with VEGFC and VEGFR3 expression but not lymphatic metastasis.
23324600 Knockdown of ADAR1 or ADAR2 affects RNA editing of GLI1.
23185371 transcription factor GLI1 mediates TGFbeta1 driven EMT in hepatocellular carcinoma via a SNAI1-dependent mechanism
23178452 Overexpression of MAP3K10 resulted in upregulation of Gli-1 and Gli-2 in pancreatic ductal adenocarcinoma cells.
23152377 The results depicted pancytopenic feature of peripheral blood, developmental anomaly of neutrophils, depression of primitive stem and progenitor population along with Shh, Ptch1, Smo and Gli1 expression in aplasia group
23146903 data uncover a role for WIP1 in modulating the activity of GLI1 and in sustaining cancer cell growth and cancer stem cell self-renewal induced by activation of the HH pathway
22949014 High GLI expression is associated with neuroblastoma.
22911366 High GLI1 mRNA expression is associated with recurrence of hepatocellular carcinoma.
22901214 High GLI1 expression is associated with colorectal cancer.
22868198 Functional activity of a Hh reporter was high only in the OSA cell line, due to an amplification at 12q, including GLI1 & other osteosarcoma-related genes.
22797820 High Gli1 expression is associated with skip metastasis of axillary lymph nodes in breast cancer.
22768056 The inhibition of CK2alpha down-regulates Hh/Gli signaling and subsequently reduces stem-like side population in human lung cancer cells.
22745574 In patients with colon cancer, Gli-1 expression level is closely related to lymph node metastases, T stages and postoperative live metastasis-free survival periods, indicative of a possible role of Gli-1 expression in colon cancer progression.
22730244 Data indicate an essential role of the HH-GLI1 signaling in controlling self-renewal and tumor initiation of melanoma CSC/TIC. Targeting HH-GLI1 is thus predicted to reduce the melanoma stem cell compartment.
22558994 Gli1 is up-regulated in hepatocellular carcinoma tissues
22486854 Results suggest that hypoxia-induced increase of Smo directly contributes to the proliferation of pancreatic ductal adenocarcinoma (PDAC) cells through a hedgehog/Gli1-independent pathway.
22407314 Expressions of Shh, Ptch1 and Gli1 were significantly correlated with stage, lymph node metastasis, venous invasion, hepatic infiltration, survival rate, and lymphatic invasion in gallbladder carcinoma.
22398221 Aberrant Gli activation is a feature of some myeloid leukemic cells and Gli activiation can be down-regulated by rapamycin.
22374725 Nuclear localization of GLI1 and elevated expression of FOXC2 in breast cancer is associated with the basal-like phenotype.
22365972 Rab23 directly associates with Su(Fu) and inhibits Gli1 function in a Su(Fu)-dependent manner.
22295843 GLI-1 might be responsible for EGF-regulated enhancement of the invasiveness of prostate cancer ARCaP(E) cells in vitro.
22266871 inhibition of Gli1 by a specific shRNA inhibits the upregulation of c-jun Ser63/73, and also inhibits the upregulation of three genes essential to NER (ERCC1, XPD) and base excision repair (XRCC1).
22114144 Gli-regulated ES-like factors induce a reprogramming event in cancer stem cells that promotes high invasion, growth and/or metastasis.
22114142 Sonic Hedgehog activates the GTPases Rac1 and RhoA in a Gli-independent manner through coupling of smoothened to Gi proteins.
22110720 DNMT1 and DNMT3a are regulated by GLI1 in pancreatic cancer, and DNMT1 is its direct target gene
22086851 findings identify GLI1 as an important positive regulator of epithelial differentiation, and they offer an explanation for how decreased levels of GLI1 are likely to contribute to the highly metastatic phenotype of PDAC
22040957 Gli1 and Gli2 are highly expressed in in non-Hodgkin's lymphoma. Expression positively correlated to clinical staging of NHL.
21940310 Hh pathway is aberrant activation in colorectal carcinoma cell line. Its inhibitor may be effectual agent for colorectal cancer chemoprevention. Gli1 maintained cell survival by binding promoter regions and facilitating transcription of IGFBP6 and Bcl-2.
21921029 A three-part signal governs differential processing of Gli1 and Gli3 proteins by the proteasome.
21861243 High GLI1 protein is associated with bladder cancer progression.
21757753 alpha subunit of the G protein G13 regulates activity of one or more Gli transcription factors independently of smoothened
21726936 Hepatitis B virus X protein acts as a positive regulator in the Hedgehog/Gli signaling pathway; results suggest that HBV infection may induce hepatocellular carcinoma by modulating post-translational activation of the hedgehog signaling components
21720384 Stable miR-302-367 cluster expression results in inhibition of CXCR4 leading to the disruption of the sonic hedgehog (SHH)-GLI-NANOG network.
21666711 found for the first time that tGLI1, but not GLI1, binds to and enhances the human vascular endothelial growth factor-A (VEGF-A) gene promoter, leading to its upregulation
21661123 Our findings suggest that Zic2 is a positive modulator increasing Gli1 transcriptional and oncogenic activity by retaining Gli1 in the nucleus of cervical cancer cells.
21633508 Data show that LNCaP-GLI1 cells displayed greater clonal growth and were more invasive than control.
21630164 In the present study, after treatment of gemcitabine-resistant cells with cyclopamine, down-regulation of Gli-1, ABCB1 and ABCG2 was observed.
21618411 The expression of GLI1 was detected in substantial subsets of embryonal RMS (ERMS) and US tumors but only rarely in alveolar RMS tumors.
21577203 Our data suggest that GLI1-mediated suppression of CYLD has a significant role in basal cell carcinoma progression.
21494603 GLI1 promotes RegIV transcription by binding to the RegIV gene promoter in pancreatic cancer.
21442356 The Gli1 promotes the growth, survival, migration, invasion and metastasis of ERalpha negative breast cancer.
21424326 High GLI1 protein expression is associated with colon cancer.
21357786 GLI1 is frequently activated in and associated with metastasis in head and neck squamous cell carcinoma.
21209912 ciliary localization of Sufu is dependent on ciliary-localized Gli proteins, and is inhibited by PKA activation
21172305 GLI1, which has been shown to play a central role in SHH signaling in prostate cancer, can act as a co-repressor to substantially block androgen receptor (AR)-mediated transactivation, at least in part, by directly interacting with AR.
21169257 Notch may directly suppress Hedgehog via Hes1 mediated inhibition of Gli1 transcription, and targeting both pathways simultaneously may be more effective at eliminating glioblastoma multiform cells.
21129534 Activation of the Hh signaling pathway in neuroblastoma & ganglioneuroblastoma may be associated with differentiation. High GLI1 expression w/o MYCN amplification was significantly associated with early clinical stage & a good prognosis.
21127038 High GLI1 is associated with chemoradiotherapy sensitivity in esophageal squamous cell carcinomas.
21059263 sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma
20972463 GLI1-upregulated MUC5AC interfered with the membrane localization of E-cadherin, leading to decreased E-cadherin-dependent cell-cell adhesion and promoting the migration and invasion of pancreatic ductal adenocarcinoma cells.
20941789 The data support a model in which the metastatic transition involves the acquisition or enhancement of a more primitive embryonic stem-like phenotype, and the downregulation of the early WNT-TCF programme, driven by oncogene-regulated high GLI1 activity.
20857406 A dependence of insulin-like growth factor (IGF) signaling on active HH/GLI1 in glioma stem cells, is described.
20818436 Our data reveal a novel mechanism of regulation of Gli1 stability and function, which influences Hedgehog/Gli1 oncogenic potential.
20799336 Study demonstrates that GLI1 is a determinant of floor plate specification in hESC and describes a highly robust and efficient in vitro model system that mimics the ventral neural tube organizer.
20711444 Pias1-dependent SUMOylation influences Gli protein activity
20647328 GLI1 is a transcriptional activator of CDK2, and this regulation occurs independent of Smoothened, the central transducer of the Hedgehog canonical pathway.
20603613 functional role of SMOH and GLI in cell survival
20581802 GLI1 also requires NANOG activity forming a positive loop, which is negatively controlled by p53 and vice versa.
20561215 proteins of the SHH signaling pathway are predominantly located within the epithelial components of GOCs and DCs. SHH signaling pathway may play a role in epithelial lining formation.
20445566 Glioma-associated oncogene homolog 1 is not a significant risk factor for inflammatory bowel disease in Caucasians.
20445566 Meta-analysis of gene-disease association. (HuGE Navigator)
20333644 Indicate that the integrin beta1/IGF-IR complex regulates expression of GLI1, which in turn promotes cancer cell proliferation in 3D cultures.
20175750 SHP overexpression decreased the expression of Gli target genes and SHP knockdown increased the expression of these genes. The results suggest that SHP can play a negative role in Hedgehog/Gli1 signalling.
20083481 The role of HH-GLI signaling in cancer focusing on the role of the GLI code, is reviewed.
20050020 GLI1 is preferentially expressed by human bulge cells vs. differentiated hair follicle keratinocytes, and positively regulate human HF stemness gene expression
20049737 Results indicate a key and essential role of the HEDGEHOG-GLI1 pathway in promoting colon cancer growth, stem cell self-renewal and metastatic behavior in advanced cancers.
19996099 Data suggest a novel mechanism in which PKA down-regulates Hedgehog signaling by promoting the interaction between 14-3-3 and Gli as well as proteolysis.
19948058 Different GLI1 genotypes alone or in combination with past sun exposure patterns as assessed in this study do not affect basal cell carcinoma risk.
19948058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19902354 demonstrate a positive association between expression of Gli1 and ERalpha.
19887615 Wnt/beta-catenin signaling induces expression of an RNA-binding protein, CRD-BP, which in turn binds and stabilizes GLI1 mRNA, causing an elevation of GLI1 expression and transcriptional activity.
19859563 GLI1 is a central mediator of EWS/FLI1 signaling in Ewing tumors
19706761 a novel gain-of-function GLI1 splice variant that promotes migration and invasiveness of glioblastoma cells
19706168 associated with breast cancer development and can be used as a tumor marker
19593328 Sonic hedgehog protein, GLI1-3 and ATP-binding cassette G2 are aberrantly expressed in diffuse large B-cell lymphoma.
19556240 The observations conclude that the GLI1-mediated up-regulation of OPN promotes malignant behavior of cancer cells.
19473442 This study found that the majority of all types of lesions, ranging from the benign but locally aggressive ameloblastoma through the varieties of odontogenic keratocysts, expressed GLI-1 throughout the width of the epithelial component.
19432668 Gli-2 rather than Gli-1 may play a pivotal role in Hedgehog protein signaling of endometrial carcinoma.
19329935 overexpression of Gli1 was an early event in endometrial carcinogenesis
19219074 A novel connection between HH/GLI pathway activity and JUN, which may contribute to the oncogenic activity of HH/GLI signaling in skin.
19214186 The balance of GLI1 and p53 functions, thus, determines cell numbers, and prevalence of p53 restricts GLI1-driven stem cell expansion and tumourigenesis.
19203449 Cyclopamine may inhibit Hedgehog-Gli1 signaling, and repress proliferation and promote apoptosis in hepatic stellate cells.
19191023 up-regulation of Gli1 in breast cancer cells may be one of the mechanisms responsible for developing estrogen independence and this process may be regulated through down-regulation of expression and transactivation of ERalpha
19189974 indicated GLI1 as a direct transcriptional target of EWS-FLI1
19071955 Reduced GLI1 function predisposes to a heightened myeloid response to inflammatory stimuli, potentially leading to IBD.
19071955 Observational study of gene-disease association. (HuGE Navigator)
19015273 Protein kinase Cdelta alters hedgehog signaling by inhibition of Gli protein transcriptional activity
18924150 p53 and GLI1 may have a role in tumor cell survival
18829525 A role ofor SIL in derepressing GLI1 from the negative control of SUFU.
18754037 Hh target genes GLI1 and PTCH1 are not expressed in lesional psoriatic skin
18524848 These results indicate a significant role for Shh-GLI signaling in the proliferation of mantle cell lymphoma.
18475300 Gli-1 nuclear expression is a strong and independent predictor of early relapse and poor prognosis in Esophageal Squamous Carcinoma after ChemoRadioTherapy - which suggests that Hh signal activation might promote cancer regrowth and progression after CRT
18425375 SHH and Gli1 mRNAs are likely to be up-regulated from adenoma and from borderline to carcinoma cells, respectively, in intraductal papillary mucinous neoplasm of the pancreas
18410405 members of the Hh pathway, especially Gli1, play an important role in the invasiveness of pancreatic cancer cells through the regulation of MMP-9 expression.
18378682 activation mechanism of the terminal transducer of the pathway, GLI1, is mediated not only by GLI1FL but also by the GLI1DeltaN variant
18281251 GLI1 does not routinely co-operate with ERK to induce the formation of basal cell carcinoma skin cancers.
18203291 Down-regulation of Bcl-2 plays an important role in apoptosis induced by Gli-1 siRNA in hepatocellular carcinoma cells
17638910 transforming growth factor-beta has a role in Smad3-dependent activation of Gli2 and Gli1 expression
17628016 mRNA expression of the hedgehog pathway target Gli1 is relatively high in approximately 25% of glioblastoma multiforme cases. Reduction of Gli levels using siRNA also reduced the viability and growth of glioma cells.
17461467 Shh-Ptch1-Gli1 signaling pathway may play a role in the progression of colorectal tumor.
17392427 Melanomas require SHH-GLI signaling regulated by interactions between GLI1 and the RAS-MEK/AKT pathways.
17196391 GLI signaling regulates the expression of stemness genes in and the self-renewal of CD133(+) glioma cancer stem cells.
17179732 In esophageal squamous cell carcinoma, Gli-1 expression was associated with tumor depth (p < 0.001), positive lymph node metastasis (p = 0.004) and a poor prognosis (p = 0.0047).
17115028 Hedgehog transcription factor Gli1 is targeted by Numb for Itch-dependent ubiquitination, which suppresses Hedgehog signals, thus arresting growth and promoting cell differentiation.
17102592 gastrointestinal neuroendocrine carcinoma cell lines express Gli1 mRNA significantly.
17018598 SCCRO regulates Gli1--a key regulator of the hedgehog (HH) pathway.
17007023 Expressions of Shh and Gli-1 were significantly higher in leiomyomas than in gastrointestinal stromal tumors. Expressions of Ptc and Smo did not correlate with histopathological differentiation.
16887337 AN11 may be a physiological regulator of GLI1 transcriptional activity
16880536 The results suggest that epidermal growth factor receptor (EGFR) signaling modulates GLI target gene profiles which may play an important regulatory role in outer root sheath (ORS) specification, hair growth, and possibly cancer.
16786128 beta-catenin might be involved in the Hh signaling pathway via enhancement of the transcriptional activity of GLI
16701100 Increased expression of SHh mRNA in human colonic adenocarcinomas and in a colorectal cell line with downstream increased expression of Gli1 mRNA known to promote cell proliferation.
16537020 Observational study of gene-disease association. (HuGE Navigator)
16434164 GLI target gene profiles correlated well with the biological activities of these transcription factors in hair follicles and basal cell carcinoma.
16293631 Protein kinase A regulates Gli1 localization and its transcriptional activity, in part, through modulating the nuclear localization signal function.
16229683 GLI1 induction was apparently inhibited by PTCH1
16003737 downregulation of Gli1 expression may be an important mechanism by which KAAD-cyclopamine inhibits growth and induces apoptosis in esophageal cancer cells
15905200 Elevated expression of hedgehog target genes human patched gene 1 (PTCH1) or Gli1 occurs in 63 of the 99 primary gastric cancers. (patched gene 1)
15606671 Quantification of Gli1 transcripts by RT-PCR is helpful in discriminating BCC and trichoepithelioma from other skin tumors.
15555571 characterization of the breakpoints of the ACTB-GLI and GLI-ACTB fusions at the genomic level in pericytoma with t(7;12)
15314219 Data report expression of sonic hedgehog-GLI-1 pathway components in adult human prostate cancer, often with enhanced levels in tumors versus normal prostatic epithelia.
15175043 GLI2 directly activates GLI1 and retrovirally expressed GLI2 induces expression of endogenous GLI1 in human primary keratinocytes
15111311 GLI oncogene is activated through fusion with the beta-actin gene (ACTB) in a group of distinctive pericytic neoplasms
15024701 CDK4, MDM2, SAS and GLI genes are amplified in leiomyosarcoma, alveolar and embryonal rhabdomyosarcoma
14555646 GLI-1 has a role in mediating bcl-2 transcriptional regulation by the sonic hedgehog signaling pathway
12907651 Loss of protein kinase Calpha expression may enhance the tumorigenic potential of Gli1 in basal cell carcinoma.
12221011 Sonic hedgehog activates expression during prostate ductal bud formation
11948912 Cooperative E-box regulation by TWIST and USF

AA Sequence 

MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSS      1 - 70
PRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMN     71 - 140
HQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDP    141 - 210
LLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELR    211 - 280
PFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAK    281 - 350
HQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG    351 - 420
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGT    421 - 490
GLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSS    491 - 560
LASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYN    561 - 630
PNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDA    631 - 700
RGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQA    701 - 770
SYPDPTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG    771 - 840
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLW    841 - 910
EGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANR    911 - 980
ASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFV    981 - 1050
AILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA                 1051 - 1106
//

Text Mined References (262)

PMID Year Title
26997450 2016 Aberrant expression of Sonic hedgehog signaling in Peutz-Jeghers syndrome.
26945969 2016 PCAF inhibits hepatocellular carcinoma metastasis by inhibition of epithelial-mesenchymal transition by targeting Gli-1.
26718507 2016 Tripartite motif 16 suppresses breast cancer stem cell properties through regulation of Gli-1 degradation via the ubiquitin-proteasome pathway.
26603838 2016 Active IKK? promotes the stability of GLI1 oncogene in diffuse large B-cell lymphoma.
26601952 2016 Nuclear Factor of Activated T Cells-dependent Down-regulation of the Transcription Factor Glioma-associated Protein 1 (GLI1) Underlies the Growth Inhibitory Properties of Arachidonic Acid.
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26544916 2016 GLI1 expression is an important prognostic factor that contributes to the poor prognosis of rhabdomyosarcoma.
26505381 2015 Gli1 expression in pancreatic ductal adenocarcinoma and its clinical significance.
26465952 2015 Sonic Hedgehog-GLI Family Zinc Finger 1 Signaling Pathway Promotes the Growth and Migration of Pancreatic Cancer Cells by Regulating the Transcription of Eukaryotic Translation Initiation Factor 5A2.
26413813 2015 GLI1 orchestrates CXCR4/CXCR7 signaling to enhance migration and metastasis of breast cancer cells.
26349604 2015 Role of GLI1 and NDRG1 in Increased Resistance to Apoptosis Induction.
26317501 2015 Targeting the Sonic Hedgehog-Gli1 Pathway as a Potential New Therapeutic Strategy for Myelodysplastic Syndromes.
26282181 2015 p53 modulates the activity of the GLI1 oncogene through interactions with the shared coactivator TAF9.
26276718 2015 Sonic hedgehog-glioma associated oncogene homolog 1 signaling enhances drug resistance in CD44(+)/Musashi-1(+) gastric cancer stem cells.
26261006 2015 Identification of GLI Mutations in Patients With Hirschsprung Disease That Disrupt Enteric Nervous System Development in Mice.
26238143 2015 Effect of Rab23 on the proliferation and apoptosis in breast cancer.
26219678 2015 The role of proto-oncogene GLI1 in pituitary adenoma formation and cell survival regulation.
26218750 2015 Cul4A overexpression associated with Gli1 expression in malignant pleural mesothelioma.
26212257 2015 Resveratrol and curcumin synergistically induces apoptosis in cigarette smoke condensate transformed breast epithelial cells through a p21(Waf1/Cip1) mediated inhibition of Hh-Gli signaling.
26107686 2015 GLI1 Transcription Factor Affects Tumor Aggressiveness in Patients With Papillary Thyroid Cancers.
26093087 2015 The gain-of-function GLI1 transcription factor TGLI1 enhances expression of VEGF-C and TEM7 to promote glioblastoma angiogenesis.
26085085 2015 Forkhead Box M1 Is Essential for Nuclear Localization of Glioma-associated Oncogene Homolog 1 in Glioblastoma Multiforme Cells by Promoting Importin-7 Expression.
25915429 2015 Chemotherapy induces the cancer-associated fibroblast phenotype, activating paracrine Hedgehog-GLI signalling in breast cancer cells.
25888497 2015 Hedgehog signaling through GLI1 and GLI2 is required for epithelial-mesenchymal transition in human trophoblasts.
25855960 2015 Histone acetyltransferase PCAF accelerates apoptosis by repressing a GLI1/BCL2/BAX axis in hepatocellular carcinoma.
25775002 2015 Hedgehog signaling pathway is active in GBM with GLI1 mRNA expression showing a single continuous distribution rather than discrete high/low clusters.
25745035 2015 Expression of Hedgehog Pathway Mediator GLI Represents a Negative Prognostic Marker in Human Acute Myeloid Leukemia and Its Inhibition Exerts Antileukemic Effects.
25686837 2015 CtBP2 is an independent prognostic marker that promotes GLI1 induced epithelial-mesenchymal transition in hepatocellular carcinoma.
25667444 2015 GLI1, CTNNB1 and NOTCH1 protein expression in a thymic epithelial malignancy tissue microarray.
25639866 2015 Hedgehog/GLI and PI3K signaling in the initiation and maintenance of chronic lymphocytic leukemia.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25588831 2015 The heterotrimeric kinesin-2 complex interacts with and regulates GLI protein function.
25586417 2015 Transcription factor glioma-associated oncogene homolog 1 is required for transforming growth factor-?1-induced epithelial-mesenchymal transition of non-small cell lung cancer cells.
25552484 2015 Sonic hedgehog and Gli1 expression predict outcome in resected pancreatic adenocarcinoma.
25501705 2015 Gli-1 is crucial for hypoxia-induced epithelial-mesenchymal transition and invasion of breast cancer.
25432698 2015 Sonic hedgehog-Gli1 signals promote epithelial-mesenchymal transition in ovarian cancer by mediating PI3K/AKT pathway.
25422081 2014 CK2?, over-expressed in human malignant pleural mesothelioma, regulates the Hedgehog signaling pathway in mesothelioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25373737 2014 Suppressor of fused (Sufu) represses Gli1 transcription and nuclear accumulation, inhibits glioma cell proliferation, invasion and vasculogenic mimicry, improving glioma chemo-sensitivity and prognosis.
25352360 2014 Association between polymorphism of GLI1 gene SNP rs2228226 and chronic lymphocytic leukemia in Chinese population.
25350271 2015 Immunolocalization of glioma-associated oncogene homolog 1 in non melanoma skin cancer.
25253693 2014 Gli1 protein regulates the S-phase checkpoint in tumor cells via Bid protein, and its inhibition sensitizes to DNA topoisomerase 1 inhibitors.
25252859 2014 Significance of glioma-associated oncogene homolog 1 (GLI1) expression in claudin-low breast cancer and crosstalk with the nuclear factor kappa-light-chain-enhancer of activated B cells (NF?B) pathway.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25166306 2014 Gli regulates MUC5AC transcription in human gastrointestinal cells.
25141859 2014 The effects of sonic hedgehog signaling pathway components on non-small-cell lung cancer progression and clinical outcome.
25134527 2014 The impact of S6K1 kinase on neuroblastoma cell proliferation is independent of GLI1 signaling.
25120849 2014 Expression of Gli1 and Wnt2B correlates with progression and clinical outcome of pancreatic cancer.
25103784 2014 Expression of the GLI family genes is associated with tumor progression in advanced lung adenocarcinoma.
25060182 2014 Expression and clinical significance of Shh/Gli-1 in papillary thyroid carcinoma.
25027328 2014 Deficiency of patched 1-induced Gli1 signal transduction results in astrogenesis in Swedish mutated APP transgenic mice.
25024229 2014 Arhgap36-dependent activation of Gli transcription factors.
25017332 2014 The transcriptional activity of Gli1 is negatively regulated by AMPK through Hedgehog partial agonism in hepatocellular carcinoma.
24926795 2014 Gli1 contributes to cellular resistance to cisplatin through altered cellular accumulation of the drug.
24889938 2014 Estrogen promotes stemness and invasiveness of ER-positive breast cancer cells through Gli1 activation.
24870236 2014 The sonic hedgehog factor GLI1 imparts drug resistance through inducible glucuronidation.
24856810 2014 Clinicopathological correlates of Gli1 expression in a population-based cohort of patients with newly diagnosed bladder cancer.
24854174 2014 Overlapping binding sites for importin ?1 and suppressor of fused (SuFu) on glioma-associated oncogene homologue 1 (Gli1) regulate its nuclear localization.
24792036 2014 Down-regulation of Gli-1 inhibits hepatocellular carcinoma cell migration and invasion.
24758269 2014 Hedgehog/Gli promotes epithelial-mesenchymal transition in lung squamous cell carcinomas.
24739390 2014 The transcription factor GLI1 interacts with SMAD proteins to modulate transforming growth factor ?-induced gene expression in a p300/CREB-binding protein-associated factor (PCAF)-dependent manner.
24733827 2014 Hedgehog pathway as a potential treatment target in human cholangiocarcinoma.
24726458 2014 Identification of novel non-coding RNA-based negative feedback regulating the expression of the oncogenic transcription factor GLI1.
24710823 2014 Activation of hedgehog signaling pathway in human non-small cell lung cancers.
24706306 2014 MiR-324-5p inhibits proliferation of glioma by target regulation of GLI1.
24678763 2014 Arsenic trioxide induces differentiation of CD133+ hepatocellular carcinoma cells and prolongs posthepatectomy survival by targeting GLI1 expression in a mouse model.
24573955 2014 Suppression of Hedgehog signalling promotes pro-tumourigenic integrin expression and function.
24470513 2014 A functional germline variant in GLI1 implicates hedgehog signaling in clinical outcome of stage II and III colon carcinoma patients.
24454730 2014 Caveolin-1 is up-regulated by GLI1 and contributes to GLI1-driven EMT in hepatocellular carcinoma.
24418624 2014 Protein kinase inhibitor SU6668 attenuates positive regulation of Gli proteins in cancer and multipotent progenitor cells.
24393846 2014 Wwox suppresses breast cancer cell growth through modulation of the hedgehog-GLI1 signaling pathway.
24393163 2014 GPCR-like signaling mediated by smoothened contributes to acquired chemoresistance through activating Gli.
24384722 2014 Gli1 inhibition suppressed cell growth and cell cycle progression and induced apoptosis as well as autophagy depending on ERK1/2 activity in human chondrosarcoma cells.
24366538 2014 GLI1 upregulates C-JUN through a specific 130-kDa isoform.
24357514 2014 MicroRNA218 inhibits glioma migration and invasion via inhibiting glioma-associated oncogene homolog 1 expression at N terminus.
24311597 2013 Structural basis of SUFU-GLI interaction in human Hedgehog signalling regulation.
24289472 2014 The clinicopathological significance and relationship of Gli1, MDM2 and p53 expression in resectable pancreatic cancer.
24223768 2013 Preferential activation of the hedgehog pathway by epigenetic modulations in HPV negative HNSCC identified with meta-pathway analysis.
24217340 2013 Structural insight into the mutual recognition and regulation between Suppressor of Fused and Gli/Ci.
24165159 2013 GLI1 interferes with the DNA mismatch repair system in pancreatic cancer through BHLHE41-mediated suppression of MLH1.
24081672 2014 Significance and prognostic value of Gli-1 and Snail/E-cadherin expression in progressive gastric cancer.
24076122 2013 Fem1b promotes ubiquitylation and suppresses transcriptional activity of Gli1.
24072710 2013 Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.
24058673 2013 Hedgehog/GLI signaling activates suppressor of cytokine signaling 1 (SOCS1) in epidermal and neural tumor cells.
24045042 2014 The GLI1 splice variant TGLI1 promotes glioblastoma angiogenesis and growth.
24013724 2013 PCAF ubiquitin ligase activity inhibits Hedgehog/Gli1 signaling in p53-dependent response to genotoxic stress.
23936094 2013 Decrease of miR-202-3p expression, a novel tumor suppressor, in gastric cancer.
23900341 2013 Gli1 transcriptional activity is negatively regulated by AKT2 in neuroblastoma.
23860225 2013 Nuclear expression of glioma-associated oncogene homolog 1 and nuclear factor-?B is associated with a poor prognosis of pancreatic cancer.
23792444 2014 The oncogenic GLI transcription factors facilitate keratinocyte survival and transformation upon exposure to genotoxic agents.
23791879 2013 Adenovirus vector-mediated Gli1 siRNA induces growth inhibition and apoptosis in human pancreatic cancer with Smo-dependent or Smo-independent Hh pathway activation in vitro and in vivo.
23788111 2013 The glioma-associated oncogene homolog 1 promotes epithelial--mesenchymal transition in human esophageal squamous cell cancer by inhibiting E-cadherin via Snail.
23757299 2013 Role of GLI-1 in epidermal growth factor-induced invasiveness of ARCaPE prostate cancer cells.
23686308 2014 Targeting Gli transcription activation by small molecule suppresses tumor growth.
23667589 2013 Gli1 mediates lung cancer cell proliferation and Sonic Hedgehog-dependent mesenchymal cell activation.
23645762 2013 Clinical significances of cancer stem cells markers in patients with intrahepatic cholangiocarcinoma who underwent hepatectomy.
23580656 2013 Transcriptional regulation of serine/threonine protein kinase (AKT) genes by glioma-associated oncogene homolog 1.
23555905 2013 Expression of the glioma-associated oncogene homolog 1 (gli1) in advanced serous ovarian cancer is associated with unfavorable overall survival.
23525267 2013 Noncanonical regulation of the Hedgehog mediator GLI1 by c-MYC in Burkitt lymphoma.
23520544 2013 Gli1 deletion prevents Helicobacter-induced gastric metaplasia and expansion of myeloid cell subsets.
23493353 2013 The prognostic significance and therapeutic potential of hedgehog signaling in intrahepatic cholangiocellular carcinoma.
23446420 2013 GLI activation by atypical protein kinase C ?/? regulates the growth of basal cell carcinomas.
23436775 2013 GLI1 regulates a novel neuropilin-2/?6?1 integrin based autocrine pathway that contributes to breast cancer initiation.
23395608 2013 Tumor suppressor protein VHL inhibits Hedgehog-Gli activation through suppression of Gli1 nuclear localization.
23337877 2013 A feedback regulation between Kindlin-2 and GLI1 in prostate cancer cells.
23336661 2013 Expression of GLI1 correlates with expression of lymphangiogenesis proteins, vascular endothelial growth factor C and vascular endothelial growth factor receptor 3, in colorectal cancer.
23324600 2013 RNA editing of the GLI1 transcription factor modulates the output of Hedgehog signaling.
23185371 2012 The transcription factor GLI1 mediates TGF?1 driven EMT in hepatocellular carcinoma via a SNAI1-dependent mechanism.
23178452 2013 MAP3K10 promotes the proliferation and decreases the sensitivity of pancreatic cancer cells to gemcitabine by upregulating Gli-1 and Gli-2.
23152377 2012 Altered canonical hedgehog-gli signalling axis in pesticide-induced bone marrow aplasia mouse model.
23146903 2013 WIP1 phosphatase modulates the Hedgehog signaling by enhancing GLI1 function.
22949014 2013 Targeting the hedgehog signal transduction pathway at the level of GLI inhibits neuroblastoma cell growth in vitro and in vivo.
22911366 2013 High expression of patched homolog-1 messenger RNA and glioma-associated oncogene-1 messenger RNA of sonic hedgehog signaling pathway indicates a risk of postresection recurrence of hepatocellular carcinoma.
22901214 2012 Expression and clinical significance of hedgehog signaling pathway related components in colorectal cancer.
22868198 2012 The activities of Smad and Gli mediated signalling pathways in high-grade conventional osteosarcoma.
22797820 2012 Study on the skip metastasis of axillary lymph nodes in breast cancer and their relation with Gli1 expression.
22768056 2012 Inhibition of CK2? down-regulates Hedgehog/Gli signaling leading to a reduction of a stem-like side population in human lung cancer cells.
22745574 2012 Expression of glioma-associated oncogene homolog 1 is associated with invasion and postoperative liver metastasis in colon cancer.
22730244 2012 Hedgehog-GLI signaling drives self-renewal and tumorigenicity of human melanoma-initiating cells.
22558994 2012 [Gli1 expression and its relationship with the expression of Shh, Vimentin and E-cadherin in human hepatocellular carcinoma].
22486854 2012 Hedgehog inhibitor decreases chemosensitivity to 5-fluorouracil and gemcitabine under hypoxic conditions in pancreatic cancer.
22439934 2012 The crosstalk of mTOR/S6K1 and Hedgehog pathways.
22407314 2012 Immunohistochemical evidence of the prognostic value of hedgehog pathway components in primary gallbladder carcinoma.
22398221 2012 Gli inhibitor GANT61 causes apoptosis in myeloid leukemia cells and acts in synergy with rapamycin.
22374725 2012 Nuclear localization of GLI1 and elevated expression of FOXC2 in breast cancer is associated with the basal-like phenotype.
22365972 2012 Rab23 negatively regulates Gli1 transcriptional factor in a Su(Fu)-dependent manner.
22295843 2012 [GLI-1 is involved in EGF-regulated enhancement of the invasiveness of prostate cancer ARCaP(E) cells in vitro].
22266871 2012 Inhibition of Gli1 results in altered c-Jun activation, inhibition of cisplatin-induced upregulation of ERCC1, XPD and XRCC1, and inhibition of platinum-DNA adduct repair.
22114144 2011 Hedgehog signaling and the Gli code in stem cells, cancer, and metastases.
22114142 2011 Sonic Hedgehog activates the GTPases Rac1 and RhoA in a Gli-independent manner through coupling of smoothened to Gi proteins.
22110720 2011 Expression of DNMT1 and DNMT3a are regulated by GLI1 in human pancreatic cancer.
22086851 2012 GLI1 inhibition promotes epithelial-to-mesenchymal transition in pancreatic cancer cells.
22040957 2011 [Expression and clinical significances of hedgehog signaling pathway in non-Hodgkin's lymphoma].
21940310 Cyclopamine blocked the growth of colorectal cancer SW116 cells by modulating some target genes of Gli1 in vitro.
21921029 2011 A three-part signal governs differential processing of Gli1 and Gli3 proteins by the proteasome.
21861243 2012 Expression of hedgehog pathway components is associated with bladder cancer progression and clinical outcome.
21757753 2011 The alpha subunit of the G protein G13 regulates activity of one or more Gli transcription factors independently of smoothened.
21726936 2011 Hepatitis B virus X protein stimulates the Hedgehog-Gli activation through protein stabilization and nuclear localization of Gli1 in liver cancer cells.
21720384 2012 The miR 302-367 cluster drastically affects self-renewal and infiltration properties of glioma-initiating cells through CXCR4 repression and consequent disruption of the SHH-GLI-NANOG network.
21666711 2012 Upregulation of VEGF-A and CD24 gene expression by the tGLI1 transcription factor contributes to the aggressive behavior of breast cancer cells.
21661123 2011 Zic2 synergistically enhances Hedgehog signalling through nuclear retention of Gli1 in cervical cancer cells.
21633508 2011 GLI1 confers profound phenotypic changes upon LNCaP prostate cancer cells that include the acquisition of a hormone independent state.
21630164 2011 Cyclopamine reverts acquired chemoresistance and down-regulates cancer stem cell markers in pancreatic cancer cell lines.
21618411 2011 Hedgehog pathway activity in pediatric embryonal rhabdomyosarcoma and undifferentiated sarcoma: a report from the Children's Oncology Group.
21577203 2011 GLI1-dependent transcriptional repression of CYLD in basal cell carcinoma.
21494603 2011 Identification of RegIV as a novel GLI1 target gene in human pancreatic cancer.
21442356 2011 Gli1 enhances migration and invasion via up-regulation of MMP-11 and promotes metastasis in ER? negative breast cancer cell lines.
21424326 2012 Prognostic value of hedgehog signaling pathway in patients with colon cancer.
21357786 2011 Glioma-associated oncogene family zinc finger 1 expression and metastasis in patients with head and neck squamous cell carcinoma treated with radiation therapy (RTOG 9003).
21209912 2010 Coordinated translocation of mammalian Gli proteins and suppressor of fused to the primary cilium.
21172305 2011 GLI1, a crucial mediator of sonic hedgehog signaling in prostate cancer, functions as a negative modulator for androgen receptor.
21169257 2010 The Notch target Hes1 directly modulates Gli1 expression and Hedgehog signaling: a potential mechanism of therapeutic resistance.
21129534 2010 Hedgehog signaling pathway in neuroblastoma differentiation.
21127038 2011 Correlation of hedgehog signal activation with chemoradiotherapy sensitivity and survival in esophageal squamous cell carcinomas.
21059263 2010 Regulation of sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 and their epigenetic status in medulloblastoma and astrocytoma.
20972463 2011 GLI1 facilitates the migration and invasion of pancreatic cancer cells through MUC5AC-mediated attenuation of E-cadherin.
20941789 2010 Loss of WNT-TCF addiction and enhancement of HH-GLI1 signalling define the metastatic transition of human colon carcinomas.
20857406 2011 Hedgehog/GLI1 regulates IGF dependent malignant behaviors in glioma stem cells.
20818436 2011 Numb activates the E3 ligase Itch to control Gli1 function through a novel degradation signal.
20799336 2010 Gli1 is an inducing factor in generating floor plate progenitor cells from human embryonic stem cells.
20711444 2010 SUMOylation by Pias1 regulates the activity of the Hedgehog dependent Gli transcription factors.
20647328 2010 Combinatorial chemoprevention reveals a novel smoothened-independent role of GLI1 in esophageal carcinogenesis.
20603613 2010 Inhibition of GLI, but not Smoothened, induces apoptosis in chronic lymphocytic leukemia cells.
20581802 2010 NANOG regulates glioma stem cells and is essential in vivo acting in a cross-functional network with GLI1 and p53.
20561215 2010 Immunohistochemical expression of SHH, PTC, SMO and GLI1 in glandular odontogenic cysts and dentigerous cysts.
20445566 2010 Evidence that glioma-associated oncogene homolog 1 is not a universal risk gene for inflammatory bowel disease in Caucasians.
20333644 2010 Beta1 integrins mediate cell proliferation in three-dimensional cultures by regulating expression of the sonic hedgehog effector protein, GLI1.
20175750 2010 SHP (small heterodimer partner) suppresses the transcriptional activity and nuclear localization of Hedgehog signalling protein Gli1.
20083481 2010 Context-dependent regulation of the GLI code in cancer by HEDGEHOG and non-HEDGEHOG signals.
20081843 2010 Histone deacetylase and Cullin3-REN(KCTD11) ubiquitin ligase interplay regulates Hedgehog signalling through Gli acetylation.
20050020 2009 Hedgehog signaling maintains hair follicle stem cell phenotype in young and aged human skin.
20049737 2009 Human colon cancer epithelial cells harbour active HEDGEHOG-GLI signalling that is essential for tumour growth, recurrence, metastasis and stem cell survival and expansion.
19996099 2010 Identification of a suppressive mechanism for Hedgehog signaling through a novel interaction of Gli with 14-3-3.
19948058 2009 GLI1 genotypes do not predict basal cell carcinoma risk: a case control study.
19902354 2010 Gli1 promotes cell survival and is predictive of a poor outcome in ERalpha-negative breast cancer.
19887615 2009 Wnt signaling stimulates transcriptional outcome of the Hedgehog pathway by stabilizing GLI1 mRNA.
19878745 2010 Identification of a novel serine/threonine kinase ULK3 as a positive regulator of Hedgehog pathway.
19859563 2009 GLI1 is a central mediator of EWS/FLI1 signaling in Ewing tumors.
19706761 2009 A novel splice variant of GLI1 that promotes glioblastoma cell migration and invasion.
19706168 2009 Expression of the glioma-associated oncogene homolog (GLI) 1 in human breast cancer is associated with unfavourable overall survival.
19593328 2009 Sonic hedgehog signaling proteins and ATP-binding cassette G2 are aberrantly expressed in diffuse large B-cell lymphoma.
19556240 2009 The hedgehog pathway transcription factor GLI1 promotes malignant behavior of cancer cells by up-regulating osteopontin.
19473442 2009 The immunoprofile of odontogenic keratocyst (keratocystic odontogenic tumor) that includes expression of PTCH, SMO, GLI-1 and bcl-2 is similar to ameloblastoma but different from odontogenic cysts.
19432668 2009 Expression of sonic hedgehog signaling molecules in normal, hyperplastic and carcinomatous endometrium.
19329935 2009 Aberrant activation of hedgehog signaling pathway contributes to endometrial carcinogenesis through beta-catenin.
19219074 2009 Cooperation between GLI and JUN enhances transcription of JUN and selected GLI target genes.
19214186 2009 A GLI1-p53 inhibitory loop controls neural stem cell and tumour cell numbers.
19203449 2009 [The effects of Hedgehog-Gli 1 signaling pathway on proliferation and apoptosis of hepatic stellate cells].
19191023 2010 Expression of Gli1 correlates with the transition of breast cancer cells to estrogen-independent growth.
19189974 2009 GLI1 is a direct transcriptional target of EWS-FLI1 oncoprotein.
19071955 2008 Analysis of germline GLI1 variation implicates hedgehog signalling in the regulation of intestinal inflammatory pathways.
19015273 2009 Protein kinase Cdelta negatively regulates hedgehog signaling by inhibition of Gli1 activity.
18924150 2009 Defining a role for Sonic hedgehog pathway activation in desmoplastic medulloblastoma by identifying GLI1 target genes.
18829525 2008 SCL/TAL1 interrupting locus derepresses GLI1 from the negative control of suppressor-of-fused in pancreatic cancer cell.
18754037 2009 Lack of evidence for activation of the hedgehog pathway in psoriasis.
18559511 2008 Protein phosphatase 2A and rapamycin regulate the nuclear localization and activity of the transcription factor GLI3.
18524848 2008 Targeting of sonic hedgehog-GLI signaling: a potential strategy to improve therapy for mantle cell lymphoma.
18475300 2008 Hedgehog signal activation in oesophageal cancer patients undergoing neoadjuvant chemoradiotherapy.
18425375 2008 Expression of Sonic hedgehog signaling pathway correlates with the tumorigenesis of intraductal papillary mucinous neoplasm of the pancreas.
18410405 2008 Gli1 contributes to the invasiveness of pancreatic cancer through matrix metalloproteinase-9 activation.
18378682 2008 Novel human glioma-associated oncogene 1 (GLI1) splice variants reveal distinct mechanisms in the terminal transduction of the hedgehog signal.
18298960 CD spectra show the relational style between Zic-, Gli-, Glis-zinc finger protein and DNA.
18281251 2008 GLI1 repression of ERK activity correlates with colony formation and impaired migration in human epidermal keratinocytes.
18203291 2008 Gli-1 siRNA induced apoptosis in Huh7 cells.
17638910 2007 Induction of sonic hedgehog mediators by transforming growth factor-beta: Smad3-dependent activation of Gli2 and Gli1 expression in vitro and in vivo.
17628016 2007 Cyclopamine-mediated hedgehog pathway inhibition depletes stem-like cancer cells in glioblastoma.
17461467 2007 Sonic hedgehog-Gli1 pathway in colorectal adenocarcinomas.
17392427 2007 Melanomas require HEDGEHOG-GLI signaling regulated by interactions between GLI1 and the RAS-MEK/AKT pathways.
17196391 2007 HEDGEHOG-GLI1 signaling regulates human glioma growth, cancer stem cell self-renewal, and tumorigenicity.
17179732 2006 Gli-1 expression is associated with lymph node metastasis and tumor progression in esophageal squamous cell carcinoma.
17115028 2006 Numb is a suppressor of Hedgehog signalling and targets Gli1 for Itch-dependent ubiquitination.
17102592 2006 Sonic Hedgehog-Gli1 signaling pathway might become an effective therapeutic target in gastrointestinal neuroendocrine carcinomas.
17035233 2006 Suppressing Wnt signaling by the hedgehog pathway through sFRP-1.
17018598 2006 Squamous cell carcinoma related oncogene/DCUN1D1 is highly conserved and activated by amplification in squamous cell carcinomas.
17007023 2006 Expressions of sonic hedgehog, patched, smoothened and Gli-1 in human intestinal stromal tumors and their correlation with prognosis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16887337 2006 HAN11 binds mDia1 and controls GLI1 transcriptional activity.
16880536 2006 Selective modulation of Hedgehog/GLI target gene expression by epidermal growth factor signaling in human keratinocytes.
16786128 2006 Enhancement of GLI1-transcriptional activity by beta-catenin in human cancer cells.
16701100 2006 Sonic Hedgehog-dependent proliferation in a series of patients with colorectal cancer.
16541075 2006 The finished DNA sequence of human chromosome 12.
16537020 2006 Association of the GLI gene with ventricular septal defect after the susceptibility gene being narrowed to 3.56 cM in 12q13.
16434164 2006 Overlapping and distinct transcriptional regulator properties of the GLI1 and GLI2 oncogenes.
16293631 2006 Regulation of Gli1 localization by the cAMP/protein kinase A signaling axis through a site near the nuclear localization signal.
16229683 2006 Inhibition of GLI1 gene activation by Patched1.
16003737 2006 Hedgehog signaling is activated in subsets of esophageal cancers.
15905200 2005 Frequent activation of the hedgehog pathway in advanced gastric adenocarcinomas.
15606671 2005 Molecular diagnosis of basal cell carcinoma and other basaloid cell neoplasms of the skin by the quantification of Gli1 transcript levels.
15555571 2004 Molecular genetic characterization of the genomic ACTB-GLI fusion in pericytoma with t(7;12).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314219 2004 Inhibition of prostate cancer proliferation by interference with SONIC HEDGEHOG-GLI1 signaling.
15175043 2004 GLI2 is expressed in normal human epidermis and BCC and induces GLI1 expression by binding to its promoter.
15111311 2004 Activation of the GLI oncogene through fusion with the beta-actin gene (ACTB) in a group of distinctive pericytic neoplasms: pericytoma with t(7;12).
15024701 2004 Amplification of CDK4, MDM2, SAS and GLI genes in leiomyosarcoma, alveolar and embryonal rhabdomyosarcoma.
14555646 2004 Transcriptional regulation of bcl-2 mediated by the sonic hedgehog signaling pathway through gli-1.
12907651 2003 Loss of protein kinase Calpha expression may enhance the tumorigenic potential of Gli1 in basal cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426310 2003 Characterization of the physical interaction of Gli proteins with SUFU proteins.
12221011 2002 Sonic hedgehog activates mesenchymal Gli1 expression during prostate ductal bud formation.
12165851 2002 Human GLI2 and GLI1 are part of a positive feedback mechanism in Basal Cell Carcinoma.
12138125 2002 Regulation of Gli1 transcriptional activity in the nucleus by Dyrk1.
11948912 2002 Cooperative E-box regulation of human GLI1 by TWIST and USF.
11717126 2001 GLI1 localization in the germinal epithelial cells alternates between cytoplasm and nucleus: upregulation in transgenic mice blocks spermatogenesis in pachytene.
11238441 2001 Physical and functional interactions between Zic and Gli proteins.
11032829 2001 Post-transcriptional regulation of the gli1 oncogene by the expression of alternative 5' untranslated regions.
11001584 2000 The sonic hedgehog-patched-gli pathway in human development and disease.
10951255 2000 Letters to the editor: identification of polymorphic variants of the GLI1 oncogene.
10806483 2000 Gli regulation by the opposing activities of fused and suppressor of fused.
10693759 2000 Hedgehog-regulated processing of Gli3 produces an anterior/posterior repressor gradient in the developing vertebrate limb.
10564661 1999 Characterization of the human suppressor of fused, a negative regulator of the zinc-finger transcription factor Gli.
10559945 1999 Mammalian suppressor-of-fused modulates nuclear-cytoplasmic shuttling of Gli-1.
10504446 1999 Gli1 protein is expressed in basal cell carcinomas, outer root sheath keratinocytes and a subpopulation of mesenchymal cells in normal human skin.
9731531 1998 Essential function of Gli2 and Gli3 in the formation of lung, trachea and oesophagus.
9524201 1998 Characterization of the promoter region and genomic organization of GLI, a member of the Sonic hedgehog-Patched signaling pathway.
9118802 1997 A binding site for Gli proteins is essential for HNF-3beta floor plate enhancer activity in transgenics and can respond to Shh in vitro.
8378770 1993 Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
3563490 1987 Identification of an amplified, highly expressed gene in a human glioma.
2850480 1988 The GLI-Kruppel family of human genes.
2832761 1988 The GLI gene is a member of the Kruppel family of zinc finger proteins.
2497059 1989 In situ hybridization localizes the human putative oncogene GLI to chromosome subbands 12q13.3-14.1.
2105456 1990 The GLI gene encodes a nuclear protein which binds specific sequences in the human genome.
1320124 1992 Molecular genetics of neurological tumours.