Property Summary

NCBI Gene PubMed Count 28
PubMed Score 74.10
PubTator Score 48.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 3.4e-06
oligodendroglioma 1.100 9.5e-03
psoriasis 1.300 2.6e-04
osteosarcoma 2.950 3.8e-06
astrocytoma 2.600 3.3e-04
juvenile dermatomyositis 1.604 3.2e-11
acute quadriplegic myopathy 1.146 3.9e-04
adrenocortical carcinoma 1.051 2.2e-05
pancreatic ductal adenocarcinoma liver m... 1.397 4.2e-02
lung adenocarcinoma 1.441 1.5e-05
Pick disease 1.400 5.7e-06
Breast cancer -1.200 1.4e-15
invasive ductal carcinoma -1.200 7.7e-03
ovarian cancer 2.500 2.7e-06
Down syndrome 1.100 9.5e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (10)

PMID Text
26792720 Our results highlight the fact that interaction between APN and ESL-1 could provide a fundamental mechanism underlying the anti-atherogenic properties of APN.
25301730 circulating prostate cancer cells' rolling capacity contributes to metastasis, and that is in part controlled by ESL-1.
22021370 Studies indicate that PSGL-1, CD44, and ESL-1 on mature leukocytes are physiologic glycoprotein ligands for endothelial P-selectin and E-selectin.
21777203 expression of Cfr in the Golgi apparatus and on the plasma membrane is finely tuned through two distinct mechanisms for exhibiting different functions.
21283832 C2GnT1 gene expression and the resulting C2-O-sLe(X) carbohydrates produced mediate the adhesive and invasive behaviors of human carcinomas which may influence their metastatic potential.
19844255 Observational study of gene-disease association. (HuGE Navigator)
19148508 under hypoxia, ESL-1 is shed from activated hepatic stellate cells
18463975 Genome-wide association study of gene-disease association. (HuGE Navigator)
15797922 a novel variant of the GLG1 gene product called GLG2 is reported; genetic analysis suggests GLG1 & GLG2 are the products of a single gene, the mRNA of which can be processed by alternative splicing to generate different transcripts encoding GLG1 or GLG2
12684670 evaluated in human brain tumors exhibiting varying degrees of malignancy

AA Sequence

MAACGRVRRMFRLSAALHLLLLFAAGAEKLPGQGVHSQGQGPGANFVSFVGQAGGGGPAGQQLPQLPQSS      1 - 70
QLQQQQQQQQQQQQPQPPQPPFPAGGPPARRGGAGAGGGWKLAEEESCREDVTRVCPKHTWSNNLAVLEC     71 - 140
LQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVCKSTITEIKECADEPVGKGYMVSCLVDHRGN    141 - 210
ITEYQCHQYITKMTAIIFSDYRLICGFMDDCKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEE    211 - 280
REPKIQVSELCKKAILRVAELSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEK    281 - 350
CREALTTRQKLIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ    351 - 420
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNCQQALQTLIQE    421 - 490
TDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVEDCEHRLLELQYFISRDWKLD    491 - 560
PVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRRLSRECRAEVQRILHQRAMDVK    561 - 630
LDPALQDKCLIDLGKWCSEKTETGQELECLQDHLDDLVVECRDIVGNLTELESEDIQIEALLMRACEPII    631 - 700
QNFCHDVADNQIDSGDLMECLIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNI    701 - 770
KKKVDVVICLSTTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNFCSAVQYG    771 - 840
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTMLQCLKQNKNS    841 - 910
ELMDPKCKQMITKRQITQNTDYRLNPMLRKACKADIPKFCHGILTKAKDDSELEGQVISCLKLRYADQRL    911 - 980
SSDCEDQIRIIIQESALDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEV    981 - 1050
LNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWS   1051 - 1120
YAAKVAPADGFSDLAMQVMTSPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR              1121 - 1179
//

Text Mined References (35)

PMID Year Title
26792720 2016 E-selectin ligand-1 (ESL-1) is a novel adiponectin binding protein on cell adhesion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25301730 2014 E-selectin ligand-1 controls circulating prostate cancer cell rolling/adhesion and metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22021370 2011 Leukocyte ligands for endothelial selectins: specialized glycoconjugates that mediate rolling and signaling under flow.
21777203 2011 Retention in the Golgi apparatus and expression on the cell surface of Cfr/Esl-1/Glg-1/MG-160 are regulated by two distinct mechanisms.
21283832 2011 C2-O-sLeX glycoproteins are E-selectin ligands that regulate invasion of human colon and hepatic carcinoma cells.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19148508 2009 Expression of E-selectin ligand-1 (CFR/ESL-1) on hepatic stellate cells: implications for leukocyte extravasation and liver metastasis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18463975 2009 A pilot genome-wide association study of early-onset breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15797922 2005 A novel isoform of human Golgi complex-localized glycoprotein-1 (also known as E-selectin ligand-1, MG-160 and cysteine-rich fibroblast growth factor receptor) targets differential subcellular localization.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12684670 2003 Identification of MG-160, a FGF binding medial Golgi sialoglycoprotein, in brain tumors: an index of malignancy in astrocytomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11404363 2001 Affinity, kinetics, and thermodynamics of E-selectin binding to E-selectin ligand-1.
9182700 1997 Latent transforming growth factor-beta complex in Chinese hamster ovary cells contains the multifunctional cysteine-rich fibroblast growth factor receptor, also termed E-selectin-ligand or MG-160.
9099943 1997 The E-selectin-ligand ESL-1 is located in the Golgi as well as on microvilli on the cell surface.
8985126 1996 Cloning and sequence analysis of the human MG160, a fibroblast growth factor and E-selectin binding membrane sialoglycoprotein of the Golgi apparatus.
8530051 1995 Assignment of the GLG1 gene for MGF-160, a fibroblast growth factor and E-selectin binding membrane sialoglycoprotein of the Golgi apparatus, to chromosome 16q22-q23 by fluorescence in situ hybridization.
7531823 1995 The E-selectin-ligand ESL-1 is a variant of a receptor for fibroblast growth factor.
2355176 1990 Immunocytochemical visualization of the Golgi apparatus in several species, including human, and tissues with an antiserum against MG-160, a sialoglycoprotein of rat Golgi apparatus.
1448090 1992 Identification of a cysteine-rich receptor for fibroblast growth factors.