Property Summary

NCBI Gene PubMed Count 24
PubMed Score 148.99
PubTator Score 42.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.700 8.9e-07
osteosarcoma -1.856 8.1e-07
group 3 medulloblastoma 1.600 1.7e-04
medulloblastoma, large-cell 1.300 1.8e-05
intraductal papillary-mucinous neoplasm ... 1.600 6.6e-04

Gene RIF (10)

PMID Text
26655997 Restoration of miR-127-3p and miR-376a-3p counteracts the neoplastic phenotype of giant cell tumor of bone derived stromal cells by targeting COA1, GLE1 and PDIA6.
25694449 Role for Gle1A during stress granule formation and translation regulation during environmental stress responses is examined.
25343993 We report the identification of the first heterozygous mutations in GLE1 ever found to be associated with amyotrophic lateral sclerosis.
24275432 Lethal congenital contracture syndrome 1 and lethal arthrogryposis with anterior horn cell disease are associated with defective Gle1 function during the export of mRNA. [review]
24243016 Report documents a requirement for Gle1 self-association during mRNA export and uncover molecular defects underlying a lethal human disease lethal congenital contracture syndrome-1.
22357925 defective zebrafish GLE1 function in human LCCS1 results in both neurogenic and non-neurogenic defects linked to the apoptosis of proliferative organ precursors
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18204449 Mutations in mRNA export mediator GLE1 result in fetal motoneuron disease.
16000379 The unique carboxyl-terminal 43 amino acid region of the hGle1B isoform mediates binding to the C-terminal non-phenylalanine- glycine region of the nucleoporin hCG1/NPL1.

AA Sequence

MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETS      1 - 70
PSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESMVLQSSRGIKVEGCVRMYELVHR     71 - 140
MKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHR    141 - 210
HRAKILNLKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQHKALLKVDLAAFQ    211 - 280
TRGNQLCSLISGIIRASSESSYPTAESQAEAERALREMRDLLMNLGQEITRACEDKRRQDEEEAQVKLQE    281 - 350
AQMQQGPEAHKEPPAPSQGPGGKQNEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKM    351 - 420
DLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQSGGRSVSVTLNPQGLDFVQYKLAEKFVKQGEE    421 - 490
EVASHHEAAFPIAVVASGIWELHPRVGDLILAHLHKKCPYSVPFYPTFKEGMALEDYQRMLGYQVKDSKV    491 - 560
EQQDNFLKRMSGMIRLYAAIIQLRWPYGNRQEIHPHGLNHGWRWLAQILNMEPLSDVTATLLFDFLEVCG    561 - 630
NALMKQYQVQFWKMLILIKEDYFPRIEAITSSGQMGSFIRLKQFLEKCLQHKDIPVPKGFLTSSFWRS      631 - 698
//

Text Mined References (28)

PMID Year Title
26655997 2016 Restoration of miR-127-3p and miR-376a-3p counteracts the neoplastic phenotype of giant cell tumor of bone derived stromal cells by targeting COA1, GLE1 and PDIA6.
25694449 2015 Cytoplasmic hGle1A regulates stress granules by modulation of translation.
25343993 2015 Deleterious mutations in the essential mRNA metabolism factor, hGle1, in amyotrophic lateral sclerosis.
24275432 2014 Insights into mRNA export-linked molecular mechanisms of human disease through a Gle1 structure-function analysis.
24243016 2013 Gle1 functions during mRNA export in an oligomeric complex that is altered in human disease.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22357925 2012 A zebrafish model of lethal congenital contracture syndrome 1 reveals Gle1 function in spinal neural precursor survival and motor axon arborization.
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18724935 2008 The mRNA export factor Gle1 and inositol hexakisphosphate regulate distinct stages of translation.
18204449 2008 Mutations in mRNA export mediator GLE1 result in a fetal motoneuron disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
16000379 2005 Interaction between the shuttling mRNA export factor Gle1 and the nucleoporin hCG1: a conserved mechanism in the export of Hsp70 mRNA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645504 2004 The mRNA export factor human Gle1 interacts with the nuclear pore complex protein Nup155.
12668658 2003 An essential role for hGle1 nucleocytoplasmic shuttling in mRNA export.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9683599 1998 Assignment of the disease locus for lethal congenital contracture syndrome to a restricted region of chromosome 9q34, by genome scan using five affected individuals.
9618489 1998 The human homologue of Saccharomyces cerevisiae Gle1p is required for poly(A)+ RNA export.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.