Property Summary

NCBI Gene PubMed Count 34
PubMed Score 65.66
PubTator Score 52.07

Knowledge Summary


No data available


  Disease (6)


  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 5.6e-07
Breast cancer 1.400 5.4e-04
glioblastoma 1.300 1.9e-04
group 3 medulloblastoma -2.700 1.0e-05
lung cancer 1.900 1.1e-02
oligodendroglioma 1.200 1.3e-02
ovarian cancer 2.600 9.6e-05
pancreatic cancer 1.500 3.4e-02
pancreatic carcinoma 1.500 3.4e-02
pancreatic ductal adenocarcinoma liver m... -2.603 7.6e-03
pediatric high grade glioma 1.200 2.8e-03
pituitary cancer -1.400 9.3e-04
psoriasis -1.700 4.4e-03

Gene RIF (17)

AA Sequence

KFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS                                  981 - 1020

Text Mined References (40)

PMID Year Title