Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.43
PubTator Score 18.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86VQ1 A4D103 Q96FD0
Symbols GCTR
GIG18
TSSN1
FAM117C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
25843653 Carriers of the rs41423247 GLCCI1 polymorphism had a higher probability of responding to glucocorticoids, whereas all other polymorphisms did not affect the likelihood of response to treatment of graft-versus-host disease patients.
25724472 Carriers of the GLCCI1-C allele had lower levels of baseline rheumatoid arthritis disease activity, suggesting a role for the GLCCI1 gene in regulation of glucocorticoid sensitivity to endogenously produced cortisol.
25134782 the minor alleles "T" and "G" of rs37972 and rs37973 SNPs, respectively, were not significantly associated with increased asthma risk in asthma patients from Saudi Arabia
24897287 GLCCI1 rs37972 T allele was not significantly associated with an increased risk of oral corticosteroid use.
24673601 GLCCI1 variant accelerates pulmonary function decline in patients with asthma receiving inhaled corticosteroids.
24131825 GLCCI1 rs37973 does not influence treatment response to inhaled corticosteroids in white subjects with asthma.
23836780 Novel association was found between intraocular pressure and a common variant at 7p21 near to GLCCI1 and ICA1.
22796022 Studied the influence of GLCCI1 SNP rs37972 on dexamethasone efficacy in bacterial meningitis patients.Results show rs37972 in GLCCI1 is associated with death in patients with CA bacterial meningitis treated with adjunctive dexamethasone therapy.
22660954 GLCCI1 nucleotide polymorphisms associated with steroid-responsiveness in asthmatic patients are unlikely to have a clinically actionable impact in pediatric nephrotic syndrome.
22304573 Variation at GLCCI1 and FCER2 could lead personalized asthma treatment.
21991891 A functional GLCCI1 variant is associated with substantial decrements in the response to inhaled glucocorticoids in patients with asthma.

AA Sequence

MSTASSSSSSSSSQTPHPPSQRMRRSAAGSPPAVAAAGSGNGAGGGGGVGCAPAAGAGRLLQPIRATVPY      1 - 70
QLLRGSQHSPTRPPVAAAAASLGSLPGPGAARGPSPSSPTPPAAAAPAEQAPRAKGRPRRSPESHRRSSS     71 - 140
PERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAE    141 - 210
EGAEKRSHQRSASWGSADQLKEQIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQATGSRSVPM    211 - 280
PLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQT    281 - 350
PSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPP    351 - 420
EGCERVKVFEEMASRQPISAPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALA    421 - 490
TLTVEQLSSRVSFTSLSDDTSTAGSMEASVQQPSQQQQLLQELQGEDHISAQNYVII                 491 - 547
//

Text Mined References (32)

PMID Year Title
25843653 2015 GLCCI1 and Glucocorticoid Receptor Genetic Diversity and Response to Glucocorticoid-Based Treatment of Graft-versus-Host Disease.
25724472 2015 Polymorphisms in the glucocorticoid receptor gene and in the glucocorticoid-induced transcript 1 gene are associated with disease activity and response to glucocorticoid bridging therapy in rheumatoid arthritis.
25134782 2015 Rs37972 and rs37973 single-nucleotide polymorphisms in the glucocorticoid-inducible 1 gene are not associated with asthma risk in a Saudi Arabian population.
24897287 2014 Pharmacogenetic analysis of GLCCI1 in three north European pediatric asthma populations with a reported use of inhaled corticosteroids.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24673601 2014 GLCCI1 variant accelerates pulmonary function decline in patients with asthma receiving inhaled corticosteroids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24131825 2014 GLCCI1 rs37973 does not influence treatment response to inhaled corticosteroids in white subjects with asthma.
23836780 2013 Genome-wide association study of intraocular pressure identifies the GLCCI1/ICA1 region as a glaucoma susceptibility locus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796022 2012 Genetic variation in GLCCI1 and dexamethasone in bacterial meningitis.
22660954 2012 GLCCI1 single nucleotide polymorphisms in pediatric nephrotic syndrome.
22304573 2012 Variation at GLCCI1 and FCER2: one step closer to personalized asthma treatment.
22187997 2011 Genetics of glucocorticoids in asthma.
21991891 2011 Genomewide association between GLCCI1 and response to glucocorticoid therapy in asthma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12557054 2003 Two genes, three messengers: hybrid transcript between a gene expressed at specific stages of T-cell and sperm maturation and an unrelated adjacent gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.