Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.100 2.5e-03
Atopic dermatitis 1.100 6.1e-04
lung adenocarcinoma 1.800 4.2e-07
lung carcinoma 1.100 4.2e-14
medulloblastoma, large-cell 1.200 2.1e-04
non-small cell lung carcinoma 1.400 1.4e-07
ovarian cancer 1.200 8.6e-11
psoriasis 1.600 5.5e-11

Gene RIF (1)

AA Sequence

MKSPPLLSPCLSWKRMAGIFFLPFISSGFAPRFKQEENFMLGRAHPSQPRFNWSHLTPLELKNRSVGLGT      1 - 70
ESTGRGKPHFTLEGHKFLIFGGSIHYFRVPREYWRDRLLKLKACGFNTVTTYVPWNLHEPERGKFDFSGN     71 - 140
LDLEAFVLMAAEIGLWVILRPGRYICSEMDLGGLPSWLLQDPRLLLRTTNKSFIEAVEKYFDHLIPRVIP    141 - 210
LQYRQAGPVIAVQVENEYGSFNKDKTYMPYLHKALLRRGIVELLLTSDGEKHVLSGHTKGVLAAINLQKL    211 - 280
HQDTFNQLHKVQRDKPLLIMEYWVGWFDRWGDKHHVKDAKEVEHAVSEFIKYEISFNVYMFHGGTNFGFM    281 - 350
NGATYFGKHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKAVYPPVRPSLYLPL    351 - 420
WDALSYLNEPVRSRQPVNMENLPINNGSGQSYGLVLYEKSICSGGRLRAHAHDVAQVFLDETMIGILNEN    421 - 490
NKDLHIPELRDCRYLRILVENQGRVNFSWQIQNEQKGITGSVSINNSSLEGFTIYSLEMKMSFFERLRSA    491 - 560
TWKPVPDSHQGPAFYCGTLKAGPSPKDTFLSLLNWNYGFVFINGRNLGRYWNIGPQKTLYLPGVWLHPED    561 - 630
NEVILFEKMMSGSDIKSTDKPTL                                                   631 - 653
//

Text Mined References (6)

PMID Year Title