Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.72
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 4.700 3.0e-08
posterior fossa group B ependymoma 2.400 4.6e-14
medulloblastoma 1.300 5.2e-05
atypical teratoid / rhabdoid tumor 2.400 1.9e-07
glioblastoma 1.300 4.8e-05
medulloblastoma, large-cell 2.300 1.2e-06
active Crohn's disease -1.407 3.1e-02
lung adenocarcinoma 1.300 1.6e-11
lung carcinoma 1.100 7.3e-05
ulcerative colitis -1.100 1.3e-04

Synonym

Accession Q8IW92 A6NCE6 Q6UX60 Q8NC62 Q8NCB3 Q8NCJ1 Q96HP3
Symbols MST114
MSTP114

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFMLEDSTFWIFGGSIHY      1 - 70
FRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGPYIC     71 - 140
SEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMSRVVPLQYKRGGPIIAVQVENEYGSYNKDPA    141 - 210
YMPYVKKALEDRGIVELLLTSDNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWT    211 - 280
GWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTE    281 - 350
AGDYTAKYMKLRDFFGSISGIPLPPPPDLLPKMPYEPLTPVLYLSLWDALKYLGEPIKSEKPINMENLPV    351 - 420
NGGNGQSFGYILYETSITSSGILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGYTVLRILVENRGR    421 - 490
VNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSLPETPTLPAFFLGSLSISST    491 - 560
PCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGPWLSSGINQVIVFEETMAGPALQFTETPHLG    561 - 630
RNQYIK                                                                    631 - 636
//

Text Mined References (8)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.