Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.85
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.407 3.1e-02
atypical teratoid / rhabdoid tumor 2.400 1.9e-07
ependymoma 2.300 4.9e-03
glioblastoma 1.300 4.8e-05
group 3 medulloblastoma 1.300 3.3e-04
lung adenocarcinoma 1.300 1.6e-11
lung carcinoma 1.100 7.3e-05
malignant mesothelioma 4.700 3.0e-08
medulloblastoma, large-cell 2.300 1.2e-06
ulcerative colitis -1.100 1.3e-04

AA Sequence

MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFMLEDSTFWIFGGSIHY      1 - 70
FRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGPYIC     71 - 140
SEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMSRVVPLQYKRGGPIIAVQVENEYGSYNKDPA    141 - 210
YMPYVKKALEDRGIVELLLTSDNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWT    211 - 280
GWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTE    281 - 350
AGDYTAKYMKLRDFFGSISGIPLPPPPDLLPKMPYEPLTPVLYLSLWDALKYLGEPIKSEKPINMENLPV    351 - 420
NGGNGQSFGYILYETSITSSGILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGYTVLRILVENRGR    421 - 490
VNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSLPETPTLPAFFLGSLSISST    491 - 560
PCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGPWLSSGINQVIVFEETMAGPALQFTETPHLG    561 - 630
RNQYIK                                                                    631 - 636
//

Text Mined References (8)

PMID Year Title