Property Summary

NCBI Gene PubMed Count 22
PubMed Score 40.22
PubTator Score 24.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 8.1e-03
medulloblastoma, large-cell 1.500 7.2e-05
osteosarcoma 1.257 1.9e-04
ovarian cancer 1.400 4.4e-10
psoriasis -3.400 9.5e-126

Gene RIF (14)

AA Sequence

MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFP      1 - 70
VSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAA     71 - 140
VDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVG    141 - 210
KRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP                  211 - 266
//

Text Mined References (22)

PMID Year Title