Property Summary

Ligand Count 11
NCBI Gene PubMed Count 66
PubMed Score 78.69
PubTator Score 59.99

Knowledge Summary

Patent (4,460)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Body Weight 14 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Disease Target Count
non-small cell lung carcinoma 317
Disease Target Count P-value
lung carcinoma 2843 1.2e-23
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.011 2.0
Obesity 678 3.976 2.0
Cushing's syndrome 48 3.764 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.300 1.2e-23

Protein-protein Interaction (1)

Gene RIF (44)

AA Sequence

MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVC      1 - 70
WDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVM     71 - 140
YTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWN    141 - 210
QALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYL    211 - 280
YENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLL    281 - 350
GVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ    351 - 420
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC                            421 - 466
//

Text Mined References (66)

PMID Year Title