Property Summary

NCBI Gene PubMed Count 63
PubMed Score 71.78
PubTator Score 59.99

Knowledge Summary

Patent (4,460)

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.300 1.2e-23

Gene RIF (42)

PMID Text
26395740 The common variant rs10423928 in the GIPR gene is associated with increased risk of stroke in patients with type 2 diabetes.
26225752 Study shows the internalization of GIPR involving clathrin-coated pits, AP-2 and dynamin and its subsequent intracellular trafficking. GIP stimulates a rapid robust internalization of the GIPR, the major part being directed to lysosomes.
25591947 The potential future role of gastric inhibitory peptide (GIP) receptors as molecular targets in neuroendocrine neoplasms may be dependent on the tumor grade.
25321336 Body mass index change for the A/T+A/A in GIPR genotypes was significantly higher than that for the T/T genotype. rs10423928 may predict weight gain in schizophrenia.
25047836 Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes.
24565507 GIPR is overexpressed in gastric and duodenal neuroendocrine tumors
24512489 GIPR expression was downregulated in subcutaneous adipose tissue from obese patients and correlated negatively with body mass index, waist circumference, systolic blood pressure, and glucose and triglyceride levels.
24446656 This study demonstrates an association between a functional GIPR polymorphism Glu354Gln (rs1800437) and Bone mineral density and fracture risk.
24238043 Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for neuroendocrine tumor imaging and therapy.
24086540 GIPR promoter was hypomethylated in type 2 diabetic patients as compared to controls.
23689510 Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor.
22956255 no detectable effect (with an OR >2.1) of the variants in GCKR, GIPR, ADCY5 and VPS13C on the response to sulfonylurea treatment, indicating that these variants are not significantly contributing to the risk of SH in patients with T2D
22412906 Functional expression of a GIP receptor mutant lacking N-glycosylation is rescued by co-expressed wild type GLP1 receptor, which suggests formation of a GIP-GLP1 receptor heteromer.
22399504 Our prospective, observational study indicates that the type 2 diabetes risk by dietary intake of carbohydrate and fat may be dependent on GIPR genotype.
22237064 The T allele of GIPR rs2287019 is associated with greater improvement of glucose homeostasis in individuals who choose a low-fat, high-carbohydrate, and high-fiber diet.
22112810 Most of the somatostatin receptor-negative neuroendocrine tumors and GLP-1 receptor-negative malignant insulinomas are GIP receptor positive.
22027838 a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis.
21789219 The role of four loci (ADCY5, GIPR, GCKR and VPS13C) in early impairment of glucose and insulin metabolism in children, was investigated.
21554434 In a proportion of acromegalic patients, GIPR overexpression appeared to be associated with a paradoxical increase in GH after an oral glucose tolerance test.
20799012 These results suggest that Tyr/His(1) and Ile/Thr(7) of GIP/GLP-1 peptides confer differential ligand selectivity toward GIPR and GLP1R.
20516203 Variations of the GIPR sequence are not associated with childhood obesity.
20516203 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20081857 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20081857 Variants at the GIPR locus associated with 2-h glucose level (rs10423928, beta (s.e.m.) = 0.09 (0.01) mmol/l per A allele, P = 2.0 x 10(-15)), were identified.
20061446 a binding mode of GIP to GIPR in which the N-terminal moiety of GIP was sited within transmembrane helices (TMH) 2, 3, 5, and 6 with biologically crucial Tyr1 interacting with Gln224 (TMH3), Arg300 (TMH5), and Phe357 (TMH6).
19386626 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R.
19254363 Our data suggest a potential relevance of GIPR variants for obesity.
19254363 Observational study of gene-disease association. (HuGE Navigator)
19211686 Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis.
19195718 Observational study of gene-disease association. (HuGE Navigator)
18971217 GIPR overexpression was observed in pediatric and adult adrenocortical tumors
17624916 Observational study of gene-disease association. (HuGE Navigator)
17624916 study identified a splice site mutation of the Glucose-dependent insulinotropic polypeptide (GIP) gene which results in a truncated protein and provides evidence for association of GIP receptor genotype with cardiovascular disease
17395281 GIPR adipose tissue gene expression was significantly lower in insulin resistant obese non-diabetic women
16087722 the promoter region of the GIP-R gene revealed six consensus sequences important in regulating the reporter gene activity and capable of binding to Sp1 and Sp3 transcription factors
15666829 Proximal promoter of GIP-R gene contains a GC-rich region capable of binding to Sp1 and SP3.
15111503 Glucose-stimulated insulin secretion is maintained despite complete absence of both GIP-1 and GIP receptors. Role for incretin receptors as essential downstream targets for glucoregulatory actions of DPP-IV inhibitors.
12721154 differences in cellular response to gastric inhibitory polypeptide(GIP) mediated by endothelin-1 may be related to differences in activation of GIP receptor splice variants
12530694 Mutation in promoter region of gip receptor gene are unlikely to underlie GIP-dependent Cushing syndrome.
12530665 Proximal 5' flanking region is TATA-less and contains a GC-rich region involved in cellular expression.

AA Sequence

MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVC      1 - 70
WDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVM     71 - 140
YTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWN    141 - 210
QALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYL    211 - 280
YENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLL    281 - 350
GVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ    351 - 420
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC                            421 - 466
//

Text Mined References (64)

PMID Year Title
26395740 2016 Glucose-Dependent Insulinotropic Polypeptide Stimulates Osteopontin Expression in the Vasculature via Endothelin-1 and CREB.
26225752 2015 Internalization and desensitization of the human glucose-dependent-insulinotropic receptor is affected by N-terminal acetylation of the agonist.
25591947 2015 Does somatostatin or gastric inhibitory peptide receptor expression correlate with tumor grade and stage in gut neuroendocrine tumors?
25321336 2015 GIPR Gene Polymorphism and Weight Gain in Patients With Schizophrenia Treated With Olanzapine.
25047836 2014 A naturally occurring GIP receptor variant undergoes enhanced agonist-induced desensitization, which impairs GIP control of adipose insulin sensitivity.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24565507 2014 GIPR expression in gastric and duodenal neuroendocrine tumors.
24512489 2014 Disruption of GIP/GIPR axis in human adipose tissue is linked to obesity and insulin resistance.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24446656 2014 A functional amino acid substitution in the glucose-dependent insulinotropic polypeptide receptor (GIPR) gene is associated with lower bone mineral density and increased fracture risk.
24238043 2013 Gastric inhibitory polypeptide receptor (GIPR) is a promising target for imaging and therapy in neuroendocrine tumors.
24086540 2013 Gastric inhibitory polypeptide receptor methylation in newly diagnosed, drug-naïve patients with type 2 diabetes: a case-control study.
23689510 2013 Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22956255 2013 Genetic variants in GCKR, GIPR, ADCY5 and VPS13C and the risk of severe sulfonylurea-induced hypoglycaemia in patients with type 2 diabetes.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22412906 2012 Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.
22399504 2012 Genetic variation in the glucose-dependent insulinotropic polypeptide receptor modifies the association between carbohydrate and fat intake and risk of type 2 diabetes in the Malmo Diet and Cancer cohort.
22344221 2012 Common variants at CDKAL1 and KLF9 are associated with body mass index in east Asian populations.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
22237064 2012 Weight-loss diets modify glucose-dependent insulinotropic polypeptide receptor rs2287019 genotype effects on changes in body weight, fasting glucose, and insulin resistance: the Preventing Overweight Using Novel Dietary Strategies trial.
22112810 2012 Glucose-dependent insulinotropic polypeptide receptors in most gastroenteropancreatic and bronchial neuroendocrine tumors.
22027838 2011 Transgenic rescue of adipocyte glucose-dependent insulinotropic polypeptide receptor expression restores high fat diet-induced body weight gain.
21789219 2011 Effects of genetic variants in ADCY5, GIPR, GCKR and VPS13C on early impairment of glucose and insulin metabolism in children.
21554434 2011 The glucose-dependent insulinotropic polypeptide receptor is overexpressed amongst GNAS1 mutation-negative somatotropinomas and drives growth hormone (GH)-promoter activity in GH3 cells.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20799012 2010 Tyr1 and Ile7 of glucose-dependent insulinotropic polypeptide (GIP) confer differential ligand selectivity toward GIP and glucagon-like peptide-1 receptors.
20516203 2010 Association of variants in gastric inhibitory polypeptide receptor gene with impaired glucose homeostasis in obese children and adolescents from Berlin.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20081857 2010 Genetic variation in GIPR influences the glucose and insulin responses to an oral glucose challenge.
20061446 2010 Identification of determinants of glucose-dependent insulinotropic polypeptide receptor that interact with N-terminal biologically active region of the natural ligand.
19386626 2009 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GIP- and GLP-1 receptors and impaired beta-cell function.
19254363 2009 Gastric inhibitory polypeptide receptor: association analyses for obesity of several polymorphisms in large study groups.
19211686 2009 Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis.
19195718 2009 A follow-up study of chromosome 19q13 in multiple sclerosis susceptibility.
18971217 2009 Expression profiles of the glucose-dependent insulinotropic peptide receptor and LHCGR in sporadic adrenocortical tumors.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17715056 2007 Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor.
17624916 2007 Association analyses of GIP and GIPR polymorphisms with traits of the metabolic syndrome.
17395281 2007 GIP receptor mRNA expression in different fat tissue depots in postmenopausal non-diabetic women.
17121608 2006 Comparative mapping reveals multiple rearrangements between pig chromosome 6 and human 19q13.
16087722 2005 The Sp transcription factors are involved in the cellular expression of the human glucose-dependent insulinotropic polypeptide receptor gene and overexpressed in adrenals of patients with Cushing's syndrome.
15666829 2004 The Sp transcription factor family is involved in the cellular expression of the human GIP-R gene promoter.
15655707 Physiology of GIP--a lesson from GIP receptor knockout mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15111503 2004 Double incretin receptor knockout (DIRKO) mice reveal an essential role for the enteroinsular axis in transducing the glucoregulatory actions of DPP-IV inhibitors.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12721154 2003 Glucose-dependent insulinotropic peptide stimulates thymidine incorporation in endothelial cells: role of endothelin-1.
12627975 2003 Structure-function analysis of a series of novel GIP analogues containing different helical length linkers.
12530694 2002 Analysis of the putative promoter region of the GIP receptor gene (GIPR) in GIP-dependent Cushing's syndrome (CS).
12530665 2002 Partial characterisation of the 5' flanking region of the human GIP receptor (GIPR) gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
10698200 2000 Osteoblast-derived cells express functional glucose-dependent insulinotropic peptide receptors.
10698169 2000 Role of G protein-coupled receptor kinases in glucose-dependent insulinotropic polypeptide receptor signaling.
9709947 1998 Adrenocortical overexpression of gastric inhibitory polypeptide receptor underlies food-dependent Cushing's syndrome.
8795084 1996 GLP-1/GIP chimeric peptides define the structural requirements for specific ligand-receptor interaction of GLP-1.
8575774 1995 Human gastric inhibitory polypeptide receptor: cloning of the gene (GIPR) and cDNA.
8243312 1993 Gastric inhibitory polypeptide receptor, a member of the secretin-vasoactive intestinal peptide receptor family, is widely distributed in peripheral organs and the brain.
7589426 1995 Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma.
7556958 1995 Cloning, functional expression, and chromosomal localization of the human pancreatic islet glucose-dependent insulinotropic polypeptide receptor.
7490109 1995 Assignment of the gastric inhibitory polypeptide receptor gene (GIPR) to chromosome bands 19q13.2-q13.3 by fluorescence in situ hybridization.