| Disease | Target Count | P-value |
|---|---|---|
| Breast cancer | 3098 | 1.0e-46 |
| non-small cell lung cancer | 2798 | 7.6e-16 |
| lung adenocarcinoma | 2714 | 2.8e-14 |
| ovarian cancer | 8491 | 4.4e-14 |
| lung carcinoma | 2844 | 1.2e-13 |
| malignant mesothelioma | 3163 | 5.3e-07 |
| lung cancer | 4473 | 7.6e-07 |
| ulcerative colitis | 2087 | 1.3e-05 |
| ductal carcinoma in situ | 1745 | 1.3e-04 |
| invasive ductal carcinoma | 2950 | 1.3e-04 |
| osteosarcoma | 7933 | 2.9e-04 |
| adrenocortical carcinoma | 1427 | 3.0e-04 |
| cystic fibrosis | 1670 | 1.6e-03 |
| psoriasis | 6685 | 2.0e-03 |
| cutaneous lupus erythematosus | 1056 | 2.7e-03 |
| nephrosclerosis | 329 | 2.9e-03 |
| pituitary cancer | 1972 | 4.7e-03 |
| esophageal adenocarcinoma | 737 | 1.8e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Crohn's disease | 304 | 0.0 | 2.0 |
| Disease | log2 FC | p |
|---|---|---|
| nephrosclerosis | -1.712 | 2.9e-03 |
| malignant mesothelioma | -2.500 | 5.3e-07 |
| esophageal adenocarcinoma | 1.400 | 1.8e-02 |
| cutaneous lupus erythematosus | -1.400 | 2.7e-03 |
| psoriasis | -1.600 | 2.0e-03 |
| osteosarcoma | -2.579 | 2.9e-04 |
| adrenocortical carcinoma | -3.177 | 3.0e-04 |
| non-small cell lung cancer | -1.296 | 7.6e-16 |
| lung cancer | -3.600 | 7.6e-07 |
| cystic fibrosis | -1.200 | 1.6e-03 |
| lung adenocarcinoma | -1.400 | 2.8e-14 |
| lung carcinoma | -1.200 | 1.2e-13 |
| Breast cancer | -2.500 | 1.0e-46 |
| ductal carcinoma in situ | -1.500 | 1.3e-04 |
| invasive ductal carcinoma | -2.000 | 1.3e-04 |
| ulcerative colitis | -1.900 | 1.3e-05 |
| ovarian cancer | -3.000 | 4.4e-14 |
| pituitary cancer | 1.800 | 4.7e-03 |
MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGFSSIQELYAQI 1 - 70 AGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNVYKSEDSLGLTITDNGVGYAF 71 - 140 IKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKAFEIELRSKA 141 - 210 GKSSGEKIGCGRATLRLRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPD 211 - 280 EFAVALDETLGDFAFPDEFVFDVWGVIGDAKRRGL 281 - 315 //
| PMID | Year | Title | |
|---|---|---|---|
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20881960 | 2010 | Hundreds of variants clustered in genomic loci and biological pathways affect human height. | |
| 19056867 | 2009 | Large-scale proteomics and phosphoproteomics of urinary exosomes. | |
| 18978678 | 2008 | Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 16169070 | 2005 | A human protein-protein interaction network: a resource for annotating the proteome. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12011974 | 2002 | GIPC gene family (Review). | |
| 11836570 | 2002 | Molecular cloning and characterization of human GIPC2, a novel gene homologous to human GIPC1 and Xenopus Kermit. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |
