Property Summary

NCBI Gene PubMed Count 64
PubMed Score 120.85
PubTator Score 99.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cholesterol embolism 5 3.3 1.7

Expression

Synonym

Accession O14908 A8K4I3 A8MZG3 Q9BTC9
Symbols NIP
GIPC
IIP-1
TIP-2
SEMCAP
C19orf3
Hs.6454
GLUT1CBP
RGS19IP1
SYNECTIN
SYNECTIIN

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (31)

PMID Text
26787837 Drd3 palmitoylation acts as a molecular switch for Drd3-biased signaling via a GIPC1-dependent route, which is likely to affect the mode of action of antipsychotic drugs.
26757732 The composite biomarker, CAPG and GIPC1 in primary breast tumors, predicted disease outcomes and benefit from zoledronate and may facilitate patient selection for adjuvant bisphosphonate treatment.
25469510 GIPC status determines the loading of cellular cargo in the exosome in pancreatic cancer cells.
23145131 GIPC binds LPA(1) and promotes its trafficking from APPL-containing signaling endosomes to EEA1 early endosomes and thus attenuates LPA-mediated Akt signaling from APPL endosomes.
23128896 Our results do not show a predictive or prognostic function of GIPC1/Synectin expression for the outcome of radiotherapy in prostate cancer.
22593212 a novel non-Smad function for endoglin and GIPC in regulating endothelial cell function during angiogenesis
22082268 The placental lectins reduced the binding of IGF-I to IGF-1 receptor in a dose-dependent manner.
21432940 Knockdown of ADRM1 in amplified ovarian cell-line OAW42 results in downregulation of growth factor GIPC1 and upregulation of tumor-suppressor RECK RNA and protein
21291857 interactions between TRP1-GIPC and GIPC-APPL-AKT provide a potential link between melanogenesis and PI3 kinase signaling
21247498 aim was to evaluate associations with albuminuria of six GLUT1 single nucleotide polymorphisms(SNPs), particularly XbaI and the previously associated Enhancer-2 (Enh2) SNP
21209904 GIPC1 plays an essential role in oncogenic transformation, and its expression is necessary for the survival of human breast and colorectal cancer cells
21047775 Findings show the importance of GIPC in breast tumor progression.
20634288 GIPC1-MyoGEF complex formation plays an important role in regulating MDA-MB-231 breast cancer cell polarization and invasion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20091192 Among several HBc-interacting partners selected, it interacted most strongly with the human protein GIPC1.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19855435 Data show that downregulation of myosin VI expression results in a significant reduction in PSA and VEGF secretion in LNCaP cells, and the intracellular targeting seems to involve myosin VI-interacting proteins, GIPC and LMTK2 and Dab2.
19016655 the C-terminal PDZ-binding motif of Glut1 plays a key role in growth factor regulation of glucose uptake by both allowing GIPC to promote Glut1 trafficking to the cell surface and protecting intracellular Glut1 from lysosomal degradation.
18775991 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC
18721486 GIPC1 is a novel breast cancer-associated immunogenic antigen that is overexpressed in breast cancer
18721484 GIPC1 protein is overexpressed in ovarian and breast cancer
18314626 Targeting GIPC could be a promising new treatment option for pancreatic cancer.
16962991 GIPC can bind to itself and that the PDZ domain is involved in GIPC-GIPC interaction
16240642 Observational study of gene-disease association. (HuGE Navigator)
16225848 These results suggest that caveolae could represent an intracellular site that contributes to differentiate IR and IGF-IR activity, and demonstrate the role of caveolin-1 in the eNOS activation by Insulin and IGF-I.
15767424 results support the notion that human papillomavirus type 18 E6 protein renders cells less sensitive to the cytostatic effect of TGF-beta by lowering the intracellular amount of TIP-2/GIPC
15356268 GIPC recruits GAIP (RGS19) to attenuate dopamine D2 receptor signaling
14507927 responsible for the recycling of the hormone that is internalized by the lutropin receptor and also for maintaining a relatively constant level of lutropin receptor at the cell surface during hormone internalization
12724327 GIPC can regulate beta1-adrenergic receptor-stimulated, Gi-mediated, ERK activation while having no effect on receptor internalization or Gs-mediated cAMP signaling
11956658 expression of human GIPC1 mRNA in normal tissues, cancer cell lines, and primary tumors
11852236 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.

AA Sequence

MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT      1 - 70
GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE     71 - 140
DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK    141 - 210
LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD    211 - 280
TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY                     281 - 333
//

Text Mined References (69)

PMID Year Title
26787837 2016 A GIPC1-Palmitate Switch Modulates Dopamine Drd3 Receptor Trafficking and Signaling.
26757732 2016 CAPG and GIPC1: Breast Cancer Biomarkers for Bone Metastasis Development and Treatment.
25469510 2014 GAIP interacting protein C-terminus regulates autophagy and exosome biogenesis of pancreatic cancer through metabolic pathways.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145131 2012 The PDZ protein GIPC regulates trafficking of the LPA1 receptor from APPL signaling endosomes and attenuates the cell's response to LPA.
23128896 2012 Impact of the adaptor protein GIPC1/Synectin on radioresistance and survival after irradiation of prostate cancer.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22593212 2012 Endoglin regulates PI3-kinase/Akt trafficking and signaling to alter endothelial capillary stability during angiogenesis.
22082268 2011 Influence of placental mannose/n-acetyl glucosamine-binding proteins on the interaction of insulin and insulin-like growth factors with their receptors.
21432940 2011 Knockdown of ovarian cancer amplification target ADRM1 leads to downregulation of GIPC1 and upregulation of RECK.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21291857 2011 Interactions between GIPC-APPL and GIPC-TRP1 regulate melanosomal protein trafficking and melanogenesis in human melanocytes.
21269460 2011 Initial characterization of the human central proteome.
21247498 2011 Genetic variation of glucose transporter-1 (GLUT1) and albuminuria in 10,278 European Americans and African Americans: a case-control study in the Atherosclerosis Risk in Communities (ARIC) study.
21209904 2010 Therapeutic implications of GIPC1 silencing in cancer.
21047775 2010 RGS-GAIP-interacting protein controls breast cancer progression.
20634288 2010 GIPC1 interacts with MyoGEF and promotes MDA-MB-231 breast cancer cell invasion.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20091192 2010 Interaction of hepatitis B virus core protein with human GIPC1.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19855435 2010 Overexpression of myosin VI in prostate cancer cells enhances PSA and VEGF secretion, but has no effect on endocytosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016655 2009 An essential role for the Glut1 PDZ-binding motif in growth factor regulation of Glut1 degradation and trafficking.
18775991 2008 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC.
18721486 2008 A human monoclonal autoantibody to breast cancer identifies the PDZ domain containing protein GIPC1 as a novel breast cancer-associated antigen.
18721484 2008 Native human autoantibodies targeting GIPC1 identify differential expression in malignant tumors of the breast and ovary.
18314626 2007 [GIPC: a new target for therapy in pancreatic adenocarcinoma?].
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16962991 2006 TRP1 interacting PDZ-domain protein GIPC forms oligomers and is localized to intracellular vesicles in human melanocytes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16240642 2005 [Analysis of polymorphic variants of gene GIPC1 CGG repeats in healthy individuals and in patients with breast cancer and non-small cell lung cancer].
16225848 2005 Insulin and IGF-I phosphorylate eNOS in HUVECs by a caveolin-1 dependent mechanism.
15767424 2005 Human papillomavirus type 18 E6 protein binds the cellular PDZ protein TIP-2/GIPC, which is involved in transforming growth factor beta signaling and triggers its degradation by the proteasome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459234 2005 CD93 interacts with the PDZ domain-containing adaptor protein GIPC: implications in the modulation of phagocytosis.
15356268 2004 GIPC recruits GAIP (RGS19) to attenuate dopamine D2 receptor signaling.
15304335 2004 Synectin in the nervous system: expression pattern and potential as a binding partner of neurotrophin receptors.
15231747 2004 A protein interaction framework for human mRNA degradation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14507927 2003 GIPC binds to the human lutropin receptor (hLHR) through an unusual PDZ domain binding motif, and it regulates the sorting of the internalized human choriogonadotropin and the density of cell surface hLHR.
12893809 2003 Myosin VI: two distinct roles in endocytosis.
12857860 2003 Myo6 facilitates the translocation of endocytic vesicles from cell peripheries.
12724327 2003 GIPC interacts with the beta1-adrenergic receptor and regulates beta1-adrenergic receptor-mediated ERK activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011974 2002 GIPC gene family (Review).
11956658 2002 Expression of human GIPC1 in normal tissues, cancer cell lines, and primary tumors.
11912251 2002 GAIP, GIPC and Galphai3 are concentrated in endocytic compartments of proximal tubule cells: putative role in regulating megalin's function.
11852236 2002 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.
11798178 2002 5T4 interacts with TIP-2/GIPC, a PDZ protein, with implications for metastasis.
11546783 2001 A novel mechanism for regulating transforming growth factor beta (TGF-beta) signaling. Functional modulation of type III TGF-beta receptor expression through interaction with the PDZ domain protein, GIPC.
11479315 2001 PDZ interaction sites in integrin alpha subunits. T14853, TIP/GIPC binds to a type I recognition sequence in alpha 6A/alpha 5 and a novel sequence in alpha 6B.
11445579 2001 A PDZ domain protein interacts with the C-terminal tail of the insulin-like growth factor-1 receptor but not with the insulin receptor.
11441007 2001 PDZ domain protein GIPC interacts with the cytoplasmic tail of melanosomal membrane protein gp75 (tyrosinase-related protein-1).
11251075 2001 GIPC and GAIP form a complex with TrkA: a putative link between G protein and receptor tyrosine kinase pathways.
10965131 2000 Assignment of PDZ domain-containing protein GIPC gene (C19orf3) to human chromosome band 19p13.1 by in situ hybridization and radiation hybrid mapping.
10911369 2000 Synectin, syndecan-4 cytoplasmic domain binding PDZ protein, inhibits cell migration.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10414980 1999 Cloning and characterization of neuropilin-1-interacting protein: a PSD-95/Dlg/ZO-1 domain-containing protein that interacts with the cytoplasmic domain of neuropilin-1.
10318831 1999 A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF.
10198040 1999 Protein interactions with the glucose transporter binding protein GLUT1CBP that provide a link between GLUT1 and the cytoskeleton.
9770488 1998 GIPC, a PDZ domain containing protein, interacts specifically with the C terminus of RGS-GAIP.
9482110 1998 The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.
8986788 1996 GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.
8895530 1996 A pancreatic cancer-specific expression profile.