Property Summary

NCBI Gene PubMed Count 8
PubMed Score 17.00
PubTator Score 6.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.800 5.5e-07
osteosarcoma 1.902 1.2e-02
medulloblastoma, large-cell 1.100 1.3e-04
non-small cell lung cancer 1.646 2.1e-17
sonic hedgehog group medulloblastoma 1.200 2.1e-06
psoriasis 1.100 7.1e-10
ovarian cancer 1.800 6.3e-09

Gene RIF (2)

PMID Text
18854154 Knockdown of GINS complex subunit 4 (GINS4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17417653 The C-terminal domains of the Sld5 and Psf1 subunits are connected by linker regions to the core complex, and the C-terminal domain of Sld5 is important for core complex assembly.

AA Sequence

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR      1 - 70
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY     71 - 140
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT    141 - 210
IAPLVASGAVQLI                                                             211 - 223
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20070258 2010 Structure and function of the GINS complex, a key component of the eukaryotic replisome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
17611626 2007 Comprehensive expression profiling of tumor cell lines identifies molecular signatures of melanoma progression.
17557111 2007 Molecular architecture of the human GINS complex.
17545466 2007 Crystal structure of the human GINS complex.
17417653 2007 Structure of the human GINS complex and its assembly and functional interface in replication initiation.
17170760 2007 The human GINS complex binds to and specifically stimulates human DNA polymerase alpha-primase.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.