Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.41
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.089 1.9e-03
adult high grade glioma 1.200 8.4e-04
astrocytic glioma 1.400 5.3e-03
Atopic dermatitis 1.200 1.2e-04
atypical teratoid / rhabdoid tumor 1.100 3.6e-05
ependymoma 1.100 4.0e-04
glioblastoma 1.100 1.4e-05
group 3 medulloblastoma 1.200 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-02
lung cancer 1.400 3.0e-02
medulloblastoma, large-cell 1.200 1.8e-03
nasopharyngeal carcinoma 1.100 2.3e-04
non-small cell lung cancer 1.261 4.0e-17
osteosarcoma -1.687 1.4e-06
primitive neuroectodermal tumor 1.100 2.4e-03
psoriasis 1.200 1.3e-43

Synonym

Accession Q9BRX5 B2RDP3 E9PB21 Q9H870
Symbols PSF3

Gene

PDB

2E9X   2EHO   2Q9Q  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPL      1 - 70
WLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQ     71 - 140
TFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRK    141 - 210
FTDMED                                                                    211 - 216
//

Text Mined References (24)

PMID Year Title