Property Summary

NCBI Gene PubMed Count 18
PubMed Score 49.32
PubTator Score 36.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
osteosarcoma -1.498 4.4e-02
glioblastoma 1.900 3.7e-05
group 3 medulloblastoma 3.200 2.5e-08
atypical teratoid / rhabdoid tumor 2.500 5.9e-09
medulloblastoma, large-cell 2.800 3.8e-06
primitive neuroectodermal tumor 2.800 1.2e-05
adrenocortical carcinoma 1.789 6.8e-06
non-small cell lung cancer 2.715 8.9e-30
intraductal papillary-mucinous carcinoma... 1.600 2.9e-03
intraductal papillary-mucinous neoplasm ... 2.300 5.7e-04
lung cancer 3.900 7.0e-06
breast carcinoma 1.200 1.1e-03
lung adenocarcinoma 1.900 7.6e-09
pediatric high grade glioma 1.600 8.6e-06
posterior fossa group A ependymoma 1.300 1.5e-05
psoriasis 1.700 1.3e-13
Endometriosis 1.373 3.1e-02
lung carcinoma 2.500 1.1e-21
Breast cancer 1.500 3.2e-08
ductal carcinoma in situ 1.900 1.3e-02
invasive ductal carcinoma 2.900 1.4e-03
acute myeloid leukemia -1.400 6.3e-03
ovarian cancer 1.300 3.7e-04
pituitary cancer 1.100 9.4e-05

Synonym

Accession Q9Y248 D3DUM5 Q6IAG9
Symbols PSF2
Pfs2
HSPC037

Gene

PANTHER Protein Class (2)

PDB

2E9X   2EHO   2Q9Q  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
25348432 High GINS2 transcript level is associated with endocrine therapy resistance in beast cancer.
24273454 On the contrary, after HL60 cells were infected by recombinant adenovirus vector which contained GINS2 gene, we observed that over-expression of GINS2 could promote HL-60 cell proliferation.
23589040 GINS2 plays an important role in apoptosis and may function via the p38MAPK signaling pathway.
22474384 Data show that using a 200-nt primed circular DNA substrate, the combined action of DNA polymerase epsilon and the Cdc45/Mcm2-7/GINS (CMG complex) leads to the formation of products >10 kb in length.
21082043 Data suggest that GINS2 to be associated with the aggressive characteristics of a subgroup of breast cancers in vivo.

AA Sequence

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK      1 - 70
LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE     71 - 140
AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF                             141 - 185
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25348432 2014 High GINS2 transcript level predicts poor prognosis and correlates with high histological grade and endocrine therapy resistance through mammary cancer stem cells in breast cancer patients.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24273454 2013 Effect of GINS2 on proliferation and apoptosis in leukemic cell line.
23589040 2013 Roles of GINS2 in K562 human chronic myelogenous leukemia and NB4 acute promyelocytic leukemia cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22474384 2012 Properties of the human Cdc45/Mcm2-7/GINS helicase complex and its action with DNA polymerase epsilon in rolling circle DNA synthesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21082043 2010 Integrative functional genomics analysis of sustained polyploidy phenotypes in breast cancer cells identifies an oncogenic profile for GINS2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
17557111 2007 Molecular architecture of the human GINS complex.
17545466 2007 Crystal structure of the human GINS complex.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17417653 2007 Structure of the human GINS complex and its assembly and functional interface in replication initiation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730134 2003 GINS, a novel multiprotein complex required for chromosomal DNA replication in budding yeast.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.