Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.62
PubTator Score 13.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
pancreatic cancer 1.200 3.3e-02
malignant mesothelioma 1.700 2.1e-07
esophageal adenocarcinoma 1.200 2.3e-02
glioblastoma multiforme 1.500 1.3e-11
group 3 medulloblastoma 2.200 5.6e-04
medulloblastoma, large-cell 1.400 1.4e-04
primitive neuroectodermal tumor 1.200 2.3e-03
Atopic dermatitis 1.200 5.5e-05
adrenocortical carcinoma 3.260 3.9e-08
pancreatic ductal adenocarcinoma liver m... 1.262 4.0e-02
non-small cell lung cancer 3.481 7.9e-31
intraductal papillary-mucinous carcinoma... 3.000 5.8e-05
intraductal papillary-mucinous neoplasm ... 3.600 2.6e-04
lung cancer 4.800 1.6e-06
lung adenocarcinoma 1.400 6.0e-10
pediatric high grade glioma 1.300 3.1e-03
atypical teratoid/rhabdoid tumor 1.400 4.6e-06
pancreatic carcinoma 1.200 3.3e-02
psoriasis 1.400 2.0e-10
nasopharyngeal carcinoma 1.900 2.5e-07
Endometriosis 1.596 1.5e-02
breast carcinoma 1.700 5.0e-36
Breast cancer 2.000 2.2e-11
ductal carcinoma in situ 2.300 2.7e-03
invasive ductal carcinoma 3.100 2.8e-04
ovarian cancer 1.600 2.7e-04
pituitary cancer 1.400 6.5e-05

Synonym

Accession Q14691 Q9NQE2 Q9NQI7
Symbols PSF1

Gene

PANTHER Protein Class (1)

PDB

2E9X   2EHO   2Q9Q  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (5)

PMID Text
21713706 PSF1 mRNA expression was an independent factor associated with prognosis of colorectal cancer.
20825491 These results suggest that PSF1 over-expression is specifically involved in breast cancer cell growth.
20103637 Findings implicate PSF1 in tumorigenesis and offer initial evidence of its potential as a theranostic target.
17417653 the C-terminal domain of Psf1 does not contribute to the stability of the GINS complex but is crucial for chromatin binding and replication activity
17127213 expression of mammalian GINS is regulated by 17beta-Estradiol-stimulated estrogen receptor alpha, and PSF3 acts as a gene responsive to transcription factor E2F1

AA Sequence

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLL      1 - 70
RNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDM     71 - 140
KPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS                  141 - 196
//

Text Mined References (19)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21713706 2011 [Expression and clinical significance of GINS complex in colorectal cancer].
21269460 2011 Initial characterization of the human central proteome.
20825491 2010 Up-regulation of PSF1 promotes the growth of breast cancer cells.
20103637 2010 PSF1, a DNA replication factor expressed widely in stem and progenitor cells, drives tumorigenic and metastatic properties.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
17611626 2007 Comprehensive expression profiling of tumor cell lines identifies molecular signatures of melanoma progression.
17557111 2007 Molecular architecture of the human GINS complex.
17545466 2007 Crystal structure of the human GINS complex.
17417653 2007 Structure of the human GINS complex and its assembly and functional interface in replication initiation.
17127213 2006 A combined computational and experimental study on the structure-regulation relationships of putative mammalian DNA replication initiator GINS.
16287864 2005 PSF1 is essential for early embryogenesis in mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.