Property Summary

NCBI Gene PubMed Count 6
PubMed Score 95.58
PubTator Score 21.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.9e-03
hepatocellular carcinoma 1.400 2.1e-04
ovarian cancer -1.200 2.1e-06
progressive supranuclear palsy -1.100 7.9e-03
psoriasis 1.400 2.6e-03
tuberculosis and treatment for 6 months -1.300 3.8e-03

Gene RIF (1)

AA Sequence

MVRSGKNGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEK      1 - 70
KKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPW     71 - 140
SLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEF    141 - 210
IQQINIELYRLFGIKQIVISHTSGTVNPTESTPNTIKAFLSKHCADHPNNWDDHLSAVSFAFNVTHLEPT    211 - 280
KNTPYFQMFSRNPYMPETSDSLHEVDGDNTSMFAKILDAIKEADKIMENKTTSLGQMENNNLDELNKSKI    281 - 350
IVKKKPKQLNPFHLKVGHEVLRQRKNWWKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSH    351 - 420
LKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGAYQANILVEDATIGIVDNELLTSSKDRELLEYRN    421 - 490
TKISPLIDDHSSLEKQTFSLLDSSNQVLEYLS                                          491 - 522
//

Text Mined References (11)

PMID Year Title