Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MTDPNKMIINLALFGMTQSGKSSAGNILLGSTDFHSSFAPCSVTTCCSLGRSCHLHSFMRRGGLEVALQV      1 - 70
QVLDTPGYPHSRLSKKYVKQEVKEALAHHFGQGGLHLALLVQRADVPFCGQEVTDPVQMIQELLGHAWMN     71 - 140
YTAILFTHAEKIEEAGLTEDKYLHEASDTLKTLLNSIQHKYVFQYKKGKSLNEQRMKILERIMEFIKENC    141 - 210
YQVLTFK                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title