Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.25
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer 1.200 1.3e-02
hepatocellular carcinoma 1.700 2.4e-05
osteosarcoma -2.160 5.2e-03
juvenile dermatomyositis 1.868 7.9e-10
tuberculosis and treatment for 6 months -1.100 5.0e-04
non-small cell lung cancer -2.371 3.6e-18
intraductal papillary-mucinous neoplasm ... -2.300 1.1e-02
breast carcinoma -1.100 2.5e-03
interstitial cystitis 1.400 3.5e-03
lung adenocarcinoma -2.600 1.2e-12
pediatric high grade glioma 1.300 5.0e-03
pilocytic astrocytoma 1.900 2.9e-06
primary Sjogren syndrome 2.600 6.3e-05
Pneumonia -1.200 3.3e-03
lung carcinoma -2.000 6.3e-15
mucosa-associated lymphoid tissue lympho... 1.065 3.5e-02
invasive ductal carcinoma -1.800 1.6e-02
acute myeloid leukemia -2.000 4.2e-02
ulcerative colitis 1.800 5.6e-04
ovarian cancer -1.500 3.1e-03

Gene RIF (2)

PMID Text
23454188 The crystal structure of GTP-bound GIMAP7 shows a homodimer assembled via the G domains, with the helical extensions protruding in opposite directions.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDT      1 - 70
KESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQ     71 - 140
SFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTE    141 - 210
ERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRI    211 - 280
WKMLSEIWHRFLSKCKFYSS                                                      281 - 300
//

Text Mined References (8)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964296 2002 Human immune associated nucleotide 1: a member of a new guanosine triphosphatase family expressed in resting T and B cells.
11814688 2002 Human ortholog to mouse gene imap38 encoding an ER-localizable G-protein belongs to a gene family clustered on chromosome 7q32-36.