Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.01
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
gastric cancer 1.500 2.8e-03
hepatocellular carcinoma 2.100 4.2e-06
pancreatic cancer 1.200 1.5e-02
psoriasis -1.500 1.5e-04
cutaneous lupus erythematosus 1.100 1.7e-02
osteosarcoma -1.791 1.5e-02
glioblastoma 1.300 4.8e-03
medulloblastoma, large-cell -1.800 7.8e-04
juvenile dermatomyositis 1.353 6.9e-09
adrenocortical carcinoma -1.322 6.3e-03
pancreatic ductal adenocarcinoma liver m... -1.440 1.1e-02
non-small cell lung cancer -2.437 3.8e-23
intraductal papillary-mucinous adenoma (... -2.400 1.4e-06
intraductal papillary-mucinous carcinoma... -2.600 1.6e-04
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-03
colon cancer -1.400 4.0e-02
lung cancer -2.600 6.1e-06
sarcoidosis 1.400 9.6e-03
breast carcinoma -1.300 8.8e-05
lung adenocarcinoma -2.400 7.0e-19
pediatric high grade glioma 1.200 1.3e-03
pilocytic astrocytoma 1.600 5.8e-06
primary Sjogren syndrome 2.000 1.6e-03
pancreatic carcinoma 1.200 1.5e-02
subependymal giant cell astrocytoma 1.407 4.4e-02
lung carcinoma -1.600 6.1e-12
spina bifida 1.107 3.9e-02
ductal carcinoma in situ -1.200 1.0e-03
invasive ductal carcinoma -1.700 4.0e-03
ulcerative colitis 1.700 2.0e-04
ovarian cancer -2.400 3.8e-05
dermatomyositis 1.400 2.3e-03

Synonym

Accession Q6P9H5 C9J7B6 D3DWZ4 Q5ZPR6 Q9H612
Symbols IAN2
IAN6
IAN-2
IAN-6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif downregulates the expression of GTPase, IMAP family member 6 (GIMAP6) in Vif-expression T cells
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKL      1 - 70
STRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQ     71 - 140
QVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEA    141 - 210
QLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESE    211 - 280
EAHRCLLGKADL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18462827 2008 Dysregulation of GIMAP genes in non-small cell lung cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097339 2002 Lymphopenia in the BB rat model of type 1 diabetes is due to a mutation in a novel immune-associated nucleotide (Ian)-related gene.
11964296 2002 Human immune associated nucleotide 1: a member of a new guanosine triphosphatase family expressed in resting T and B cells.
11814688 2002 Human ortholog to mouse gene imap38 encoding an ER-localizable G-protein belongs to a gene family clustered on chromosome 7q32-36.