Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.27
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 8.3e-03
Breast cancer -2.700 3.2e-02
breast carcinoma -1.100 1.1e-04
ductal carcinoma in situ -1.300 6.4e-04
gastric cancer 1.100 6.5e-03
group 4 medulloblastoma -1.500 2.4e-03
hepatocellular carcinoma 1.200 6.8e-04
interstitial cystitis 1.200 7.1e-04
intraductal papillary-mucinous adenoma (... -1.700 1.2e-03
intraductal papillary-mucinous carcinoma... -1.100 3.3e-05
intraductal papillary-mucinous neoplasm ... -2.100 2.8e-03
invasive ductal carcinoma -1.600 6.1e-03
lung adenocarcinoma -1.100 1.1e-15
lung carcinoma -1.100 4.4e-07
medulloblastoma, large-cell -2.000 6.0e-07
non-small cell lung cancer -2.002 4.5e-19
osteosarcoma -1.335 4.6e-02
ovarian cancer -1.800 1.2e-04
pancreatic cancer 1.100 8.4e-03
pancreatic carcinoma 1.100 8.4e-03
Pick disease 1.300 1.1e-02
primary Sjogren syndrome 1.700 1.6e-03
tuberculosis and treatment for 6 months -1.300 9.1e-04
ulcerative colitis 1.300 9.3e-04

Gene RIF (4)

AA Sequence

MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGATSVTRACTTGS      1 - 70
RRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQLGRFTAQDQQAVRQVRDMFG     71 - 140
EDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEG    141 - 210
LVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL    211 - 280
LLGGALLFWVLLHRRWSEAVAEVGPD                                                281 - 306
//

Text Mined References (13)

PMID Year Title