Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.07
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.7e-04
ductal carcinoma in situ -1.300 9.2e-05
glioblastoma -1.100 5.2e-05
intraductal papillary-mucinous neoplasm ... -1.100 3.5e-02
invasive ductal carcinoma -1.600 1.7e-04
lung cancer 1.100 4.2e-03
medulloblastoma, large-cell -1.100 4.8e-03
ovarian cancer -1.400 1.5e-06
spina bifida -1.058 3.9e-02

AA Sequence

MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVP      1 - 70
LPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYD     71 - 140
VEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQ    141 - 210
YAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEW    211 - 280
YQSLNLTHVPEHSAPIYEFR                                                      281 - 300
//

Text Mined References (7)

PMID Year Title