Property Summary

NCBI Gene PubMed Count 129
PubMed Score 324.52
PubTator Score 454.20

Knowledge Summary

Patent (34,605)

 GWAS Trait (1)

Gene RIF (125)

PMID Text
27129257 GHS-R1b not only determines the efficacy of ghrelin-induced GHS-R1a-mediated signaling but also determines the ability of GHS-R1a to form oligomeric complexes with other receptors.
25727097 Study demonstrates that the GHS-R1a/5-HT2C receptor interaction translates into a biologically significant modulation of ghrelin's orexigenic effect
25603164 The data indicates that GHSR hypermethylation is a pan-cancer marker regardless of the tissue from which the tumor originates.
25524946 the single nucleotide polymorphism of GHSR might be weaker association with cancer risk, especially with breast cancer risk
25376984 This study suggests that the rs696217 and rs2075356 ghrelin gene (GHRL) polymorphisms may protect carriers against breast cancer, and the rs4684677 GHRL and rs572169 GHSR polymorphisms may increase the risk among carriers.[Meta-analysis]
25261469 findings suggest an avenue for modulating drug abuse-associated changes in synaptic plasticity via GHSR1a and indicate the development of GHSR1a-biased ligands as a promising strategy for selectively targeting downstream signaling events.
25200304 Data (including data from knockout mice) suggest ghrelin produced in pancreatic islets regulates insulin secretion and thereby regulates blood glucose; ghrelin signaling via growth hormone secretagogue-receptor appears to be involved. [REVIEW]
24809812 The Ghr and GHSR-1a were co-expressed by the pigmented epithelium (PE) of the CB, by the retinal pigmented epithelium (RPE) and by the anterior limiting layer (ALL) of the iris.
24651458 Data indicate that activation of growth hormone secretagogue receptor (GHSR) may trigger a diversity of signaling mechanisms and subsequent distinct physiological responses.
24194510 Studies suggest that dysregulation in the components of the ghrelin system including ghrelin, ghrelin receptor (GHSR1a) and ghrelin-O-acyl-transferase can lead to or influence the development and/or progression of highly concerning pathologies.
23982275 We found that ghrelin and GHSR1a are expressed in ovarian epithelial carcinoma in vivo and in vitro. Ghrelin inhibits the proliferation and growth of HO-8910 cells by G1 phase arrest.
23839942 Heterodimerization with Its splice variant blocks the ghrelin receptor 1a in a non-signaling conformation: a study with a purified heterodimer assembled into lipid discs.
23816797 In the posterior segment, the ghrelin-GHSR-1a system interferes with the development of oxygen-induced retinopathy, being protective in the vaso-obliterative phase and deleterious in the vaso-proliferative stage of the disease. (Review)
23807739 Ghrelin induces cell proliferation, migration and invasion via GHS-R/NF-kappaB signaling pathway in gastric cancer cells.
23722988 GHSROS, which is expressed in lung cancer and stimulates cell migration in lung cancer cell lines, contributes to the growing number of non-coding RNAs that play a role in the regulation of tumourigenesis and metastatic cancer progression.
23515787 Ghrelin and NUCB2/nesfatin-1 are expressed in the same gastric cell and differentially correlated with body mass index in obese subjects.
23161547 Promiscuous dimerization of the growth hormone secretagogue receptor (GHS-R1a) attenuates ghrelin-mediated signaling
23079033 Ghrelin alone or in combination with TNF-alpha may prove to be a novel indicator of coronary atherosclerosis.
22899222 a link between epigenetic down-regulation of GHSR and breast cancer cell invasion
22876551 Despite the major role of ghrelin in growth and appetite regulation, our results indicate that mutations in ghrelin and GHSR do not explain short stature and weight regulation disorders in children in our population.
22846991 high constitutive activity of the ghrelin receptor is dependent upon flexibility in the C-terminal segment of extracellular loop 2
22632858 Deregulation of ghrelin/ghrelin receptor signaling can lead to either development of obesity or anorexia nervosa. [REVIEW]
22632856 Ghrelin/growth hormone secretagogue receptor signaling plays biologically/clinically relevant roles by influencing energy metabolism, growth hormone secretion, inflammatory responses, cardiovascular performance, and behavior. [REVIEW]
22573814 Using the ghrelin receptor reconstituted as a monomer into lipid discs and labeled with a fluorescent conformational reporter, we demonstrate that ligand efficacy and functional selectivity are directly related to different receptor conformations.
22465164 data suggested that in species expressing both motilin-MR and ghrelin-GHSR, there is a compensatory relationship in vivo
22457237 Longitudinal study between birth & 10 years in a popul-based cohort revealed a significant association of the rs482204 and rs562416 GHSR polymorphisms on height, whereas no association between GHSR polymorphisms and weight or BMI was ascertainable
22411573 association analysis between genotypes for SNPs rs9819506 and rs490683 of the GHSR gene promoter and weight loss following Roux-en-Y gastric bypass surgery; role of increased ghrelin levels in weight loss outcomes following RYGB surgery may be influenced by variation in the GHSR gene
22327910 Interaction of the melanocortin 3 receptor (MC3R) and the growth hormone secretagogue receptor (GHSR)-1a results in a modulation of function in both receptors.
22117076 The distinct ligand requirements for the interaction of purified GHS-R1a with arrestin and AP2 provide a new rationale to the differences in basal and agonist-induced internalization observed in cells.
22087538 Immunohistochemical staining revealed expression of ghrelin and GHSR1alpha both in glandular endometrioid epithelium and in some stromal cells, particularly in some fibroblasts, blood vessels and infiltrating leukocytes.
21956643 Ghrelin receptors are expressed by distal tubules of the mouse kidney.
21930173 The studies do not support the hypothesis of GHSR polymorphisms being significant contributors of obesity risk, Type 2 Diabetes mellitus risk, eating disorders, or height determination. (Review)
21903149 ghrelin receptors can be retained in the endoplasmic reticulum by heterodimerization with GHS-R1b, and constitutive activation of phospholipase C is attenuated due to decreased cell surface expression of ghrelin receptors
21664965 An association of a haplotype in the GHSR gene with multiple sclerosis was found in one patient cohort, but it could not be replicated in a second patient cohort.
21646290 Novel inactivating mutations in the GH secretagogue receptor gene in patients with constitutional delay of growth and puberty.
21616122 Human ghrelin axis-derived molecules, ghrelin receptors and RNA transcripts, many of which may play important roles in health and disease, are reviewed.
21606657 The SNPs of the ghrelin signaling system were associated with decreased self-directedness.
21269581 GHST rs509035, rs512692 and rs2922126 polymorphisms are not risk factors for clinically evident cardiovascular disease in patients with rheumatoid arthritis.
21145775 A-501C SNP is associated with earlier onset of rheumatoid arthritis suggesting that genetic variations in the ghrelin gene may have an impact on rheumatoid arthritis.
21084395 Our results suggest that GHSR1A mutations contribute to the genetic etiology of short stature in the Japanese population
20920174 A joint analysis of the two populations indicated that the T allele of rs27647 SNP exerted a protective borderline effect (Ptrend = 0.004).
20920174 Observational study of gene-disease association. (HuGE Navigator)
20861603 Molecular analysis of GHSR did not show any mutations, but showed some polymorphisms. None of these polymorphisms were related to IGF-I levels, ghrelin levels, BMI-SDS or height SDS.
20804798 Expression of myocardial ghrelin and GHSR-1a is directly associated with myocardial function: CHF hearts exhibit an impaired ghrelin production which might reflect maladaptive processes and an - probably compensatory - increase in GHSR-1a expression.
20727371 Cys residues in extracellular domains in the family of Class A G protein-coupled receptors is likely involved in the highly conserved and functionally important disulfide bond, and perimembranous residues contribute peptide ligand binding and signaling.
20636306 Examined the effects of exercise on ghrelin plasma concentrations in children. The study showed a correlation between the proportional increase of acylated ghrelin and the duration of exercise.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616368 Report low expression of ghrelin and GHSR in mid-secretory endometria of women with unexplained infertility.
20599926 characterization and modeling of wildtype GHSR1a and mutants; investigation of significance of W276 and TM III domain in signaling activity of GHSR1a
20586762 the GHSR is associated with BMI as well as with smoking
20586762 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20404923 A rare functional GHSR promoter mutation variant was identified, yet there was no consistent relationship with obesity in neither family- nor population-based studies
20404923 Observational study of gene-disease association. (HuGE Navigator)
20346234 the GHSR gene polymorphisms do not appear to play a major role in rheumatoid arthritis genetic predisposition in our Caucasian Spanish population
20346234 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20185531 Observational study of gene-disease association. (HuGE Navigator)
20164039 The GHS-R was shown in the glandular part of the pituitary and CNS during the whole period of intrauterine life.
20150876 Gsp mutations may upregulate the expression of GHSR-1a mRNA and have no effect on ghrelin mRNA levels in human GH-secreting pituitary adenomas.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19887765 Differences exist in ghrelin receptor expression in lymphocytes isolated from stable cystic fibrosis patients with different body mass indices.
19876004 Observational study of gene-disease association. (HuGE Navigator)
19789204 Firsst case of growth hormone deficiency due to GHSR mutation.
19782690 His280 was proposed to stabilize Trp276 in the active state; this was verified by site-directed mutagenesis and biochemical characterization of the resulting H280A and H280S mutants, which were functional but shared a decrease of their basal activities.
19670151 GHS-R mRNA expression was high in pituitary, adrenal gland, and spinal cord.
19506043 epistatic effects of five candidate genes, including ADIPOQ, ENPP1, GHSR, PPAR and TCF7L2, are significantly associated with the risk of DN amongst Taiwanese T2D individuals.
19506043 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19487270 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19262695 beta-arrestins and c-Src are implicated in the activation of Akt in response to ghrelin through the GHS-R1a
19165163 Common polymorphisms in ghrelin and its receptor genes are not major contributors to the development of polygenic obesity, although common variants may alter body weight and eating behavior.
19165163 Observational study of gene-disease association. (HuGE Navigator)
19088192 GHRH interacts with ghrelin receptor GHS-R1a, and, in consequence, modifies the ghrelin-associated intracellular signaling pathway
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19024096 The polymorphisms within GHSR might be a genetic risk factor for metabolic syndrome in women.
19024096 Observational study of gene-disease association. (HuGE Navigator)
18945286 Variants of the ghrelin and GHSR genes are not major contributors to height variation in a French population.
18945286 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18828808 This first study of single nucleotide polymorphisms (SNPs) of the GHS-R1A gene shows that association with heavy alcohol consumption correlates with body mass in heavy alcohol consuming individuals.
18828808 Observational study of gene-disease association. (HuGE Navigator)
18698404 Polymorphisms in the GHSR promoter may modify changes in body weight during long-term lifestyle intervention and affect ghrelin receptor signalling through modulation of GHSR gene expression.
18647811 Common variation in GHSR is not associated with body size in U.K. adults or children.
18573679 Data suggest that expression of prostanoid receptors (prostaglandin E2 EP3-I, prostacyclin, and thromboxane A2 receptors) in vascular inflammation could influence cell responses dependent on the constitutive activation of ghrelin receptors.
18426818 higher expression of GHSR-1a in the ACTH-dependent Cushing patients responsive to GHRP-6, suggesting an association between receptor gene expression and in vivo response to the secretagogue
18425803 Higher GHSR-1a is associated with Crohn's disease.
18375957 A number of GHRL and GHSR polymorphisms were associated with body mass index (BMI) and height.
18375957 Observational study of gene-disease association. (HuGE Navigator)
18064392 Our results showed that ghrelin receptor was expressed in cancers throughout the gastrointestinal tract, mainly in the cytoplasm of mucosal layer cells.
17885924 HepG2 cells do not express a GHS-R1a-type ghrelin receptor
17601657 These findings demonstrate in a defined system that unacylated ghrelin does not antagonize activation of the GHS-R by ghrelin.
17494105 This study demonstrates the cyclical expression of GHS-R and ghrelin in human endometrium.
17428235 Adenosine is not a direct GHSR agonist. In human embryonic kidney 293s (HEK) cells expressing GHSR, adenosine activates endogenously expressed A(2B)R resulting in calcium mobilization.
17324965 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17229547 Investigation of whether the full-length GRLN-R physically interacts with its truncated splice variant GHS-R1b
17018595 NMU & its cancer-specific receptors NTSR1 & GHSR1b, as well as its target genes, are overexpressed in lung cancer and in cell lines, and that those gene products play indispensable roles in the growth and progression of lung cancer cells.
16787234 This overview focuses on recent studies of tissue distribution, expression regulation and the multiple actions of the ghrelin receptor (GHS-R) and its involvement in the control of energy homeostasis and its ability to stimulate food intake and adiposity.
16606630 Observational study of gene-disease association. (HuGE Navigator)
16582936 ghrelin, through GHSR-1a, activates the Elk1 transcriptional factor and ERK1/2 by a PLC- and PKCepsilon-dependent pathway
16567594 Observational study of gene-disease association. (HuGE Navigator)
16567594 Variants in ghrelin receptor are associated with parameters of left ventricular mass and geometry independent of blood pressure and body mass in general population and may be involved in pathogenesis of left ventricular hypertrophy.
16527811 Ghrelin and the growth hormone secretagogue receptor have roles in astrocytoma motility
16511605 A GHSR missense mutation segregates with short stature resulting in decreased cell-surface expression of the receptor and selective impairment of the constitutive activity of GHSR, while preserving its ability to respond to ghrelin.
16511600 Review concludes that selective lack of ghrelin receptor constitutive signaling leads to a syndrome characterized not only by short stature, but also by obesity that apparently develops during puberty.
16362631 Observational study of gene-disease association. (HuGE Navigator)
16362631 the 171T/C polymorphism of the ghrelin receptor gene in patients diagnosed with Eating disorders
16020971 Downregulation of GHS-R1a and high levels of GHS-R1b transcripts are associated with adrenal tumors
15616037 Single nucleotide polymorphisms and haplotypes within the GHSR region are involved in the pathogenesis of human obesity.
15585554 ovarian surface epithelium and related tumors are potential targets for systemic or locally produced ghrelin because they express the functional type 1a GHS-R
15383539 ghrelin receptor, neurotensin receptor 2 and GPR39 display an unusually high degree of constitutive activity, determined by an aromatic cluster on the inner face of the extracellular ends of TMs VI and VII
15232612 potential use of ghrelin and GHS-R agonists in the management of disease-associated cachexia.
15080774 Observational study of gene-disease association. (HuGE Navigator)
15080774 genetic variations in the GHS-R1a gene are not the main regulators of IGF-I levels
14763915 Specific ghrelin (GHS) binding sites, other than GHS-R1a and 1b, are present in human prostatic neoplasms. Ghrelin, in addition to des-acyl ghrelin, exerts different effects on cell proliferation in prostate carcinoma cell lines.
14715878 results demonstrate that ghrelin and the type 1a growth hormone secretagogue receptor are expressed in adult human testis and testicular tumors
14715843 Observational study of gene-disease association. (HuGE Navigator)
14715843 no conclusive evidence for an involvement of the ghrelin receptor gene in body weight regulation or short normal stature
14701677 Constitutive overexpression of GHSR can up-regulate basal signaling activity in the GHRH/GH axis and reduce adiposity without affecting other GHSR-mediated signals.
12574228 The presence of ligand and receptor of the ghrelin signaling system within the human ovary opens up the possibility of a potential regulatory role of this novel molecule in ovarian function under physiological and pathophysiological conditions.
12511847 Review. This review will summarize data regarding the structure of the GHS-R gene and the protein encoded, reports investigating the expression and control of the GHS-R in various tissues, and studies of the underlying transcriptional mechanisms.
12045256 Hypothalamic growth hormone secretagogue receptor regulates growth hormone secretion, feeding, and adiposity
8688086 The 1b variant may not be functional, it only encodes 5 of the 7 transmembrane domains and fails to respond in xenopus oocytes.

AA Sequence

MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSR      1 - 70
FRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVE     71 - 140
RYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLL    141 - 210
TVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFH    211 - 280
VGRYLFSKSFEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLST    281 - 350
LKDESSRAWTESSINT                                                          351 - 366
//

Text Mined References (129)

PMID Year Title
27129257 2016 A Significant Role of the Truncated Ghrelin Receptor GHS-R1b in Ghrelin-induced Signaling in Neurons.
25727097 2015 Ghrelin's Orexigenic Effect Is Modulated via a Serotonin 2C Receptor Interaction.
25603164 2015 GHSR hypermethylation: a promising pan-cancer marker.
25524946 2015 No association of single nucleotide polymorphisms involved in GHRL and GHSR with cancer risk: a meta-analysis.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25376984 2014 Associations between ghrelin and ghrelin receptor polymorphisms and cancer in Caucasian populations: a meta-analysis.
25261469 2014 G Protein and ?-arrestin signaling bias at the ghrelin receptor.
25200304 2014 Ghrelin signalling in ?-cells regulates insulin secretion and blood glucose.
24809812 2014 Novel evidence of ghrelin and growth hormone segretagogue receptor expression by human ocular tissues.
24651458 2014 The growth hormone secretagogue receptor: its intracellular signaling and regulation.
24194510 2014 Ghrelin gene products, receptors, and GOAT enzyme: biological and pathophysiological insight.
23982275 2013 Ghrelin inhibits ovarian epithelial carcinoma cell proliferation in vitro.
23839942 2013 Heterodimerization with Its splice variant blocks the ghrelin receptor 1a in a non-signaling conformation: a study with a purified heterodimer assembled into lipid discs.
23816797 2013 Ghrelin in ocular pathophysiology: from the anterior to the posterior segment.
23807739 2013 Ghrelin induces gastric cancer cell proliferation, migration, and invasion through GHS-R/NF-?B signaling pathway.
23722988 2013 Identification of a long non-coding RNA gene, growth hormone secretagogue receptor opposite strand, which stimulates cell migration in non-small cell lung cancer cell lines.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23515787 2013 Ghrelin and NUCB2/nesfatin-1 are expressed in the same gastric cell and differentially correlated with body mass index in obese subjects.
23161547 2013 Promiscuous dimerization of the growth hormone secretagogue receptor (GHS-R1a) attenuates ghrelin-mediated signaling.
23079033 2012 Serum ghrelin level and TNF-?/ghrelin ratio in patients with previous myocardial infarction.
22899222 2012 Diagnostic values of GHSR DNA methylation pattern in breast cancer.
22876551 2012 Ghrelin and growth hormone secretagogue receptor (GHSR) genes are not commonly involved in growth or weight abnormalities in an Israeli pediatric population.
22846991 2012 Modulation of constitutive activity and signaling bias of the ghrelin receptor by conformational constraint in the second extracellular loop.
22632858 2012 The role of NPY and ghrelin in anorexia nervosa.
22632856 2012 The growth hormone secretagogue receptor (Ghs-R).
22573814 2012 Ligands and signaling proteins govern the conformational landscape explored by a G protein-coupled receptor.
22465164 2012 A relationship between motilin and growth hormone secretagogue receptors.
22457237 2012 GH secretagogue receptor gene polymorphisms are associated with stature throughout childhood.
22411573 2012 Association of ghrelin receptor promoter polymorphisms with weight loss following Roux-en-Y gastric bypass surgery.
22327910 2012 MC4R dimerization in the paraventricular nucleus and GHSR/MC3R heterodimerization in the arcuate nucleus: is there relevance for body weight regulation?
22117076 2012 High constitutive activity is an intrinsic feature of ghrelin receptor protein: a study with a functional monomeric GHS-R1a receptor reconstituted in lipid discs.
22087538 2012 Expression of ghrelin and its receptors in ovarian endometrioma.
21956643 2011 Ghrelin receptors are expressed by distal tubules of the mouse kidney.
21930173 2011 Genetic studies on the ghrelin, growth hormone secretagogue receptor (GHSR) and ghrelin O-acyl transferase (GOAT) genes.
21903149 2012 The truncated ghrelin receptor polypeptide (GHS-R1b) is localized in the endoplasmic reticulum where it forms heterodimers with ghrelin receptors (GHS-R1a) to attenuate their cell surface expression.
21664965 Polymorphisms in genes encoding leptin, ghrelin and their receptors in German multiple sclerosis patients.
21646290 2011 Novel inactivating mutations in the GH secretagogue receptor gene in patients with constitutional delay of growth and puberty.
21616122 2011 Ghrelin axis genes, peptides and receptors: recent findings and future challenges.
21606657 2011 Reward-related genes and personality traits in alcohol-dependent individuals: a pilot case control study.
21269581 Analysis of the influence of the ghrelin receptor rs509035, rs512692 and rs2922126 polymorphisms in the risk of cardiovascular disease in patients with rheumatoid arthritis.
21145775 2011 Ghrelin gene polymorphisms in rheumatoid arthritis.
21084395 2011 Identification and functional analysis of novel human growth hormone secretagogue receptor (GHSR) gene mutations in Japanese subjects with short stature.
20920174 2010 Polymorphisms of genes coding for ghrelin and its receptor in relation to colorectal cancer risk: a two-step gene-wide case-control study.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20861603 2011 Ghrelin plasma levels in patients with idiopathic short stature.
20804798 2010 Altered myocardial expression of ghrelin and its receptor (GHSR-1a) in patients with severe heart failure.
20727371 2011 Mutational analysis of predicted extracellular domains of human growth hormone secretagogue receptor 1a.
20636306 2011 Acylated ghrelin increases after controlled short-time exercise in school-aged children.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616368 2010 Diminished endometrial expression of ghrelin and ghrelin receptor contributes to infertility.
20599926 2010 Involvement of tryptophan W276 and of two surrounding amino acid residues in the high constitutive activity of the ghrelin receptor GHS-R1a.
20586762 2010 Genetic variation of the ghrelin signaling system in females with severe alcohol dependence.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20404923 2010 Family and population-based studies of variation within the ghrelin receptor locus in relation to measures of obesity.
20346234 Association study of ghrelin receptor gene polymorphisms in rheumatoid arthritis.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20185531 2010 Contrasting association of a non-synonymous leptin receptor gene polymorphism with Wegener's granulomatosis and Churg-Strauss syndrome.
20164039 2009 Assessment of ghrelin, GHS-R, GH, and neurohormones in human fetal pituitary glands and central nervous system: an immunohistochemical study.
20150876 2010 Elevation of growth hormone secretagogue receptor type 1a mRNA expression in human growth hormone-secreting pituitary adenoma harboring G protein alpha subunit mutation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19887765 2010 Ghrelin receptor expression in lymphocytes isolated from adult cystic fibrosis patients.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19789204 2009 Recessive isolated growth hormone deficiency and mutations in the ghrelin receptor.
19782690 2010 Activation of the ghrelin receptor is described by a privileged collective motion: a model for constitutive and agonist-induced activation of a sub-class A G-protein coupled receptor (GPCR).
19670151 2009 Expression of ghrelin and its receptor in human tissues.
19506043 2009 Association and interaction analyses of genetic variants in ADIPOQ, ENPP1, GHSR, PPARgamma and TCF7L2 genes for diabetic nephropathy in a Taiwanese population with type 2 diabetes.
19487270 2009 A study of relationships between single nucleotide polymorphisms from the growth hormone-insulin-like growth factor axis and bone mass: the Hertfordshire cohort study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19262695 2009 c-Src regulates Akt signaling in response to ghrelin via beta-arrestin signaling-independent and -dependent mechanisms.
19165163 2009 Association studies on ghrelin and ghrelin receptor gene polymorphisms with obesity.
19088192 2008 Growth hormone-releasing hormone as an agonist of the ghrelin receptor GHS-R1a.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19024096 2008 Ghrelin receptor gene polymorphisms are associated with female metabolic syndrome in Chinese population.
18945286 2009 A genetic study of the ghrelin and growth hormone secretagogue receptor (GHSR) genes and stature.
18828808 2008 Association of pro-ghrelin and GHS-R1A gene polymorphisms and haplotypes with heavy alcohol use and body mass.
18698404 2008 Variations in the ghrelin receptor gene associate with obesity and glucose metabolism in individuals with impaired glucose tolerance.
18647811 2008 Ghrelin receptor gene polymorphisms and body size in children and adults.
18573679 2008 The constitutive activity of ghrelin receptors is decreased by co-expression with vasoactive prostanoid receptors when over-expressed in human embryonic kidney 293 cells.
18426818 2008 Association between tumoral GH-releasing peptide receptor type 1a mRNA expression and in vivo response to GH-releasing peptide-6 in ACTH-dependent Cushing's syndrome patients.
18425803 2008 Phenotypical and functional study of ghrelin and its receptor in the pathogenesis of Crohn's disease.
18375957 2008 Polymorphisms of genes coding for ghrelin and its receptor in relation to anthropometry, circulating levels of IGF-I and IGFBP-3, and breast cancer risk: a case-control study nested within the European Prospective Investigation into Cancer and Nutrition (EPIC).
18064392 2007 Involvement of ghrelin-growth hormone secretagogue receptor system in pathoclinical profiles of digestive system cancer.
17885924 2007 The hepatocarcinoma cell line HepG2 does not express a GHS-R1a-type ghrelin receptor.
17601657 2007 Unacylated ghrelin is not a functional antagonist but a full agonist of the type 1a growth hormone secretagogue receptor (GHS-R).
17494105 2007 Facilitation of decidualization by locally produced ghrelin in the human endometrium.
17428235 2007 Adenosine is not a direct GHSR agonist--artificial cross-talk between GHSR and adenosine receptor pathways.
17324965 2007 Epistatic interaction between haplotypes of the ghrelin ligand and receptor genes influence susceptibility to myocardial infarction and coronary artery disease.
17229547 2007 The truncated ghrelin receptor polypeptide (GHS-R1b) acts as a dominant-negative mutant of the ghrelin receptor.
17018595 2006 The neuromedin U-growth hormone secretagogue receptor 1b/neurotensin receptor 1 oncogenic signaling pathway as a therapeutic target for lung cancer.
16787234 2006 Growth hormone secretagogue (ghrelin-) receptors--a complex drug target for the regulation of body weight.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16606630 2006 Polymorphisms in genes involved in GH1 release and their association with breast cancer risk.
16582936 2006 Regulation of ERK1/2 activity by ghrelin-activated growth hormone secretagogue receptor 1A involves a PLC/PKCvarepsilon pathway.
16567594 2006 Association of the Ghrelin receptor gene region with left ventricular hypertrophy in the general population: results of the MONICA/KORA Augsburg Echocardiographic Substudy.
16527811 2006 Ghrelin and the growth hormone secretagogue receptor constitute a novel autocrine pathway in astrocytoma motility.
16511605 2006 Loss of constitutive activity of the growth hormone secretagogue receptor in familial short stature.
16511600 2006 Ghrelin receptor mutations--too little height and too much hunger.
16362631 2006 Association of ghrelin receptor gene polymorphism with bulimia nervosa in a Japanese population.
16020971 2005 Loss of growth hormone secretagogue receptor 1a and overexpression of type 1b receptor transcripts in human adrenocortical tumors.
15616037 2005 Genetic linkage and association of the growth hormone secretagogue receptor (ghrelin receptor) gene in human obesity.
15585554 2005 Expression of growth hormone secretagogue receptor type 1a, the functional ghrelin receptor, in human ovarian surface epithelium, mullerian duct derivatives, and ovarian tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383539 2004 Common structural basis for constitutive activity of the ghrelin receptor family.
15232612 2004 Ghrelin inhibits leptin- and activation-induced proinflammatory cytokine expression by human monocytes and T cells.
15080774 2004 Sequencing analysis of the ghrelin receptor (growth hormone secretagogue receptor type 1a) gene.
15062547 2004 Identification and functional characterization of two alternatively spliced growth hormone secretagogue receptor transcripts from the pituitary of black seabream Acanthopagrus schlegeli.
14763915 2004 Expression of ghrelin and biological activity of specific receptors for ghrelin and des-acyl ghrelin in human prostate neoplasms and related cell lines.
14755130 2004 Agonist-specific coupling of growth hormone secretagogue receptor type 1a to different intracellular signaling systems. Role of adenosine.
14719137 2004 Growth hormone secretagogue receptor subtypes 1a and 1b are expressed in the human adrenal cortex.
14715878 2004 Expression of ghrelin and its functional receptor, the type 1a growth hormone secretagogue receptor, in normal human testis and testicular tumors.
14715843 2004 Ghrelin receptor gene: identification of several sequence variants in extremely obese children and adolescents, healthy normal-weight and underweight students, and children with short normal stature.
14701677 2004 Physiological studies of transgenic mice overexpressing growth hormone (GH) secretagogue receptor 1A in GH-releasing hormone neurons.
12890514 2003 Growth hormone secretagogue receptors in rat and human gastrointestinal tract and the effects of ghrelin.
12574228 2003 Immunolocalization of ghrelin and its functional receptor, the type 1a growth hormone secretagogue receptor, in the cyclic human ovary.
12511847 2002 Structure and regulation of the growth hormone secretagogue receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045256 2002 Hypothalamic growth hormone secretagogue receptor regulates growth hormone secretion, feeding, and adiposity.
11356716 2001 Genomic structure and transcriptional regulation of the human growth hormone secretagogue receptor.
11322507 2001 Growth hormone secretagogue receptor family members and ligands.
11322498 2001 Interactions of growth hormone secretagogues and growth hormone-releasing hormone/somatostatin.
11227737 2001 Cortistatin, but not somatostatin, binds to growth hormone secretagogue (GHS) receptors of human pituitary gland.
10604470 1999 Ghrelin is a growth-hormone-releasing acylated peptide from stomach.
9852035 1998 Cloning and characterization of the 5'-flanking region of the human growth hormone secretagogue receptor gene.
9092793 1997 Molecular analysis of rat pituitary and hypothalamic growth hormone secretagogue receptors.
8688086 1996 A receptor in pituitary and hypothalamus that functions in growth hormone release.
601898 1977 [Giardia lamblia and other intestinal parasites in children in day-institutions. Incidence and significance].