Property Summary

NCBI Gene PubMed Count 65
PubMed Score 1883.40
PubTator Score 2158.53

Knowledge Summary

Patent

No data available

Gene RIF (43)

PMID Text
26671997 GHRH excess and blockade in X-LAG syndrome
23689947 After 20 weeks of GHRH administration, gamma-aminobutyric acid levels are increased in all brain regions, N-acetylaspartylglutamate levels are increased in the dorsolateral frontal cortex, and myoinositol levels are decreased in the posterior cingulate.
23542451 case Report: multiple endocrine neoplasia type 1 family characterized by primary hyperparathyroidism, in association with acromegaly because of ectopic GHRH secretion by a pancreatic neuroendocrine tumor in a young man.
22423511 The pathomechanisms involved in the genetic defects at both ends of the GHRH-IGF-1 axis.
21715545 GHRH mutations were not identified in a selected cohort of patients with isolated GH deficiency, suggesting that, if they exist, they may be an extremely rare cause of isolated GH deficiency.
21478211 The present paper will give an overview of the main cardiovascular actions of the ghrelin gene-derived peptides and of GHRH.
21274339 Studies indicate that appropriate consideration should be given to genetic defects in GH-1, IGF-I and GHRH causing growth hormone (GH) deficiency.
21196925 Data show that GHRH can stimulate the secretion of IL-17 from human peripheral blood mononuclear cells.
20869425 A single nucleotide polymorphism (SNP) in GnRH shows relationship to central precocious puberty in Chinese Han girls.
20843274 Pretreatment with GHRH for 12 days could restore pituitary responsiveness to GHRH either in healthy aged men and growth hormone-deficient adult patients.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20673733 the juxtapositions between GHRH axonal varicosities may be functional synapses and may represent the morphological substrate of the synchronized release of GHRH in the human hypothalamus.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20633588 Results demonstrate that a positive correlation exists between the endocrine potency and the antiproliferative efficacy of GHRH antagonists in tumors strongly expressing pGHRH-R.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20518847 GHRH stimulated the NF-kappa b transcription factor, which is not only known to activate angiogenic factors but also the expression of genes involved in encoding enzymes in the prostaglandin-synthesis pathway such as COX-2 and the iNOS
20453000 Observational study of gene-disease association. (HuGE Navigator)
20372804 growth hormone-releasing hormone has a role as a growth factor in diverse tissues and various tumors
20169434 The common regenerative and neuroprotective effects of epidermal growth factor (EGF) and growth hormone releasing hormone peptide(GHRP)-6 are associated with their versatile pro-survival and pro-regenerative mechanisms.
20150954 decreased GHRH-induced GH secretion has a role in cardiovascular disease in obese women
19622623 Our study was conducted on putatively sporadic IGHD patients. Thus, the finding of a dominant mutation with incomplete penetrance is not in contrast with previous reports of a recessive inheritance of GHRHR mutations.
19524226 GHRH mRNA was found in transformed human endometriotic stromal cells.
19487270 There is a relationship between allelic variation in the gene encoding GHRH and bone density.
19487270 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19088192 GHRH interacts with ghrelin receptor GHS-R1a, and, in consequence, modifies the ghrelin-associated intracellular signaling pathway
19086053 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18684444 Variations in GHRH splice variants may play a role in promoting the development of endometriosis.
18329818 GHRH enhanced the ghrelin-induced GH secretion but had no effect on cortisol secretion
17546465 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17372203 GHRH operates as a growth factor in breast cancer and probably other cancers as well
16606630 Observational study of gene-disease association. (HuGE Navigator)
16214911 Observational study of gene-disease association. (HuGE Navigator)
15538933 Endogenous GHRH is indispensable for the nocturnal augmentation of GH secretion, but that it is unlikely to participate in the genesis of slow-wave sleep.
15362970 autocrine stimulatory loop between GHRH and SV1 variant of GHRH receptor in primary breast cancers
12511850 Review. Growth hormone-releasing hormone (GHRH) is a hypothalamic hormone that is essential for normal expansion of the somatotrope lineage during pituitary development.
12424433 GHRH is essential for the somatotrope cellular proliferation that normally occurs during development-REVIEW
12364462 presence of GHRH and its tumoral receptor splice variants in prostate cancers suggests the possible existence of an autocrine mitogenic loop
12213676 expressed in a subset of endometrial tumors, of the endometrioid type in particular; A paracrine/autocrine role for GHRH in the development of the disease should be considered
12186980 expression in gastroenteropancreatic carcinomas
12126741 human GHRH is expressed in experimental prostate neoplasms in mice; this could explain the effects of GHRH antagonists on growth of prostate cancer

AA Sequence

MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERG      1 - 70
ARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG                                     71 - 108
//

Text Mined References (66)

PMID Year Title
26671997 2016 GHRH excess and blockade in X-LAG syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23689947 2013 Growth hormone-releasing hormone effects on brain ?-aminobutyric acid levels in mild cognitive impairment and healthy aging.
23542451 2013 Growth hormone-releasing hormone-producing pancreatic neuroendocrine tumor in a multiple endocrine neoplasia type 1 family with an uncommon phenotype.
22423511 2011 From GHRH to IGF-1 and downstream: clinical phenotypes and biological mechanisms.
21715545 2011 Absence of GH-releasing hormone (GHRH) mutations in selected patients with isolated GH deficiency.
21478211 2011 Cardiovascular actions of the ghrelin gene-derived peptides and growth hormone-releasing hormone.
21274339 2010 Genetics of isolated growth hormone deficiency.
21196925 2010 Growth hormone-releasing hormone stimulates the secretion of interleukin 17 from human peripheral blood mononuclear cells in vitro.
20869425 2010 An association study between the genetic polymorphisms within GnRHI, LH? and FSH? genes and central precocious puberty in Chinese girls.
20843274 2011 Difference in growth hormone response to growth hormone-releasing hormone (GHRH) testing following GHRH subacute treatment in normal aging and growth hormone-deficient adults: possible perspectives for therapeutic use of GHRH or its analogs in elderly subjects?
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20673733 2010 Distribution and morphology of the juxtapositions between growth hormone-releasing hormone-(ghrh)-immunoreactive neuronal elements.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20633588 2010 A correlation of endocrine and anticancer effects of some antagonists of GHRH.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20518847 2011 Growth hormone releasing hormone induces the expression of nitric oxide synthase.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20372804 2010 Effects of growth hormone-releasing hormone and its agonistic and antagonistic analogs in cancer and non-cancerous cell lines.
20169434 2011 Therapeutic effect of the combined use of growth hormone releasing peptide-6 and epidermal growth factor in an axonopathy model.
20150954 2010 The decreased growth hormone response to growth hormone releasing hormone in obesity is associated to cardiometabolic risk factors.
19622623 2009 A recurrent signal peptide mutation in the growth hormone releasing hormone receptor with defective translocation to the cell surface and isolated growth hormone deficiency.
19524226 2010 The growth hormone-releasing hormone (GHRH) antagonist JV-1-36 inhibits proliferation and survival of human ectopic endometriotic stromal cells (ESCs) and the T HESC cell line.
19487270 2009 A study of relationships between single nucleotide polymorphisms from the growth hormone-insulin-like growth factor axis and bone mass: the Hertfordshire cohort study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19088192 2008 Growth hormone-releasing hormone as an agonist of the ghrelin receptor GHS-R1a.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18684444 2009 Expression and possible implication of growth hormone-releasing hormone receptor splice variant 1 in endometriosis.
18329818 2008 Ghrelin alone or co-administered with GHRH or CRH increases non-REM sleep and decreases REM sleep in young males.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17546465 2007 Common genetic variation in eight genes of the GH/IGF1 axis does not contribute to adult height variation.
17372203 2007 Stimulation of proliferation of MCF-7 breast cancer cells by a transfected splice variant of growth hormone-releasing hormone receptor.
16606630 2006 Polymorphisms in genes involved in GH1 release and their association with breast cancer risk.
16214911 2005 Genetic variation in the growth hormone synthesis pathway in relation to circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3, and breast cancer risk: results from the European prospective investigation into cancer and nutrition study.
15538933 2004 Blockade of endogenous growth hormone-releasing hormone receptors dissociates nocturnal growth hormone secretion and slow-wave sleep.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15362970 2004 Immunohistochemical detection of GHRH and its receptor splice variant 1 in primary human breast cancers.
12867592 2003 Ligand-dependent and -independent effects of splice variant 1 of growth hormone-releasing hormone receptor.
12511850 2002 Growth hormone-releasing hormone and pituitary somatotrope proliferation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424433 2002 Growth Hormone Releasing Hormone (GHRH) and the GHRH Receptor.
12364462 2002 Expression of growth hormone-releasing hormone and its receptor splice variants in human prostate cancer.
12213676 2002 Expression of growth hormone-releasing hormone in human primary endometrial carcinomas.
12186980 2002 The expression of growth hormone-releasing hormone (GHRH) and splice variants of its receptor in human gastroenteropancreatic carcinomas.
12126741 2002 Expression of growth hormone-releasing hormone (GHRH) and splice variants of GHRH receptors in human experimental prostate cancers.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11773624 2002 Expression of a splice variant of the receptor for GHRH in 3T3 fibroblasts activates cell proliferation responses to GHRH analogs.
10537133 1999 The mutant growth hormone-releasing hormone (GHRH) receptor of the little mouse does not bind GHRH.
8670892 1996 Dominant dwarfism in transgenic rats by targeting human growth hormone (GH) expression to hypothalamic GH-releasing factor neurons.
8421089 1993 Congenital gigantism due to growth hormone-releasing hormone excess and pituitary hyperplasia with adenomatous transformation.
8020943 1994 Genetic mapping of the human growth hormone-releasing factor gene (GHRF) using two intragenic polymorphisms detected by PCR amplification.
7680413 1993 Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone.
6812220 1982 Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly.
6415488 1983 Expression-cloning and sequence of a cDNA encoding human growth hormone-releasing factor.
6192430 1983 Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.
3918305 1985 Gene encoding human growth hormone-releasing factor precursor: structure, sequence, and chromosomal assignment.
3029387 1986 Solution structure of human growth hormone releasing factor. Combined use of circular dichroism and nuclear magnetic resonance spectroscopy.
3008329 1986 Receptor-associated resistance to growth hormone-releasing factor in dwarf "little" mice.
3002494 Total DNA synthesis and cloning in Escherichia coli of a gene coding for the human growth hormone releasing factor.
2992358 1985 Growth hormone releasing factors.
2857452 1985 Heterogeneity of growth-hormone deficiency.
2854259 Solution conformations of human growth hormone releasing factor: comparison of the restrained molecular dynamics and distance geometry methods for a system without long-range distance data.
1333056 1992 Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone.