Property Summary

NCBI Gene PubMed Count 21
PubMed Score 64.14
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.058 2.8e-02
Multiple myeloma 1.891 5.8e-04
glioblastoma -1.300 3.5e-06
atypical teratoid / rhabdoid tumor -1.500 3.2e-08
medulloblastoma -1.400 1.7e-06
medulloblastoma, large-cell -1.400 1.9e-05
pancreatic ductal adenocarcinoma liver m... -1.766 4.4e-02
adult high grade glioma -1.200 5.7e-04
non primary Sjogren syndrome sicca 1.200 2.6e-02
Alzheimer's disease -1.200 2.3e-02
Pick disease -1.500 7.9e-07
ovarian cancer 2.000 1.6e-03

 GO Process (1)

Gene RIF (6)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
20877624 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18440869 The tmbim5 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments
18417609 MICS1 individually functions in mitochondrial morphology and cytochrome c release.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPS      1 - 70
MEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTAL     71 - 140
SAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTIL    141 - 210
GGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAM    211 - 280
YGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK         281 - 345
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440869 2008 Comparative genomics and function analysis on BI1 family.
18417609 2008 Identification of a novel protein MICS1 that is involved in maintenance of mitochondrial morphology and apoptotic release of cytochrome c.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.