Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.48
PubTator Score 2.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acromegaly 51 3.778 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.003 1.6e-02

Synonym

Accession Q8N2G8 B4DQS4 E9PDB5 Q9BXM6
Symbols LGP1
D11LGP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

AA Sequence

MLLWPLLLLLLLLPTLALLRQQRSQDARLSWLAGLQHRVAWGALVWAATWQRRRLEQSTLHVHQSQQQAL      1 - 70
RWCLQGAQRPHCSLRRSTDISTFRNHLPLTKASQTQQEDSGEQPLPPTSNQDLGEASLQATLLGLAALNK     71 - 140
AYPEVLAQGRTARVTLTSPWPRPLPWPGNTLGQVGTPGTKDPRALLLDALRSPGLRALEAGTAVELLDVF    141 - 210
LGLETDGEELAGAIAAGNPGAPLRERAAELREALEQGPRGLALRLWPKLQVVVTLDAGGQAEAVAALGAL    211 - 280
WCQGLAFFSPAYAASGGVLGLNLQPEQPHGLYLLPPGAPFIELLPVKEGTQEEAASTLLLAEAQQGKEYE    281 - 350
LVLTDRASLTRCRLGDVVRVVGAYNQCPVVRFICRLDQTLSVRGEDIGEDLFSEALGRAVGQWAGAKLLD    351 - 420
HGCVESSILDSSAGSAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVGPARVHLVGQG    421 - 490
AFRALRAALAACPSSPFPPAMPRVLRHRHLAQCLQERVVS                                  491 - 530
//

Text Mined References (11)

PMID Year Title