Property Summary

NCBI Gene PubMed Count 38
PubMed Score 1735.52
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Gene RIF (19)

PMID Text
26589570 Type 1 diabetic women delivering large for gestational age infants had lower placental GH levels in early pregnancy.
24035309 genetic association studies in populations in Estonia, Czech Republic, and Bashkortostan/Russia: Data suggest an SNP in GH2 (rs2006123) is associated with adult height (not body mass index); A-allele is associated with taller stature. [META-ANALYSIS]
23178941 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
22489624 Maternal serum PGH at 11-13 weeks' gestation is unlikely to be a useful biochemical marker for early prediction of small for gestational age neonates.
22387044 results are consistent with a pleiotropic effect of placental hGH/CSH genes at the maternal-fetal interface relating to the regulation of fetal growth and the risk of affected maternal metabolism.
22363400 These results suggest that the normal PGH-IGF-I-IGFBP3 axis in pregnancy is abnormal in Type 1 Diabetic pregnancies.
20403354 Observational study of gene-disease association. (HuGE Navigator)
20005926 The hGH-V promoter activity and the endogenous mRNA expression in human placental choriocarcinoma cell line JAR in the presence of glucose and demethylating genome conditions, were compared.
19844941 early first trimester maternal serum marker for Down syndrome
18976975 Knockdown of growth hormone 2 (GH2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18356738 Placental growth hormone (PGH) secretion by BeWo cells is regulated by hormonal factors and adipokines. Elevated insulin and leptin levels might down-regulate PGH secretion.
17701665 PGH may play a role in the mechanisms of disease in preeclampsia and fetal growth restriction.
15718272 results offer the first evidence for a placental role of human placental growth hormone(hPGH) and suggest an autocrine/paracrine role of hPGH in the regulation of trophoblast invasion
15563602 Using a mutagenesis-scanning analysis of 81 single and 32 pairwise double mutations, it is shown that the GHv hormone's two spatially distal receptor binding sites (Site1 and Site2) are allosterically coupled
15531513 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14595650 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
12946357 Data show that improved binding affinity of human growth hormone (hGH(v)) results from numerous small contributions distributed broadly over the interface.
12213191 GH-V plays a major role in affecting target cells expressing the GH receptor, thus potentially exerting significant GH-like effects on maternal physiology during pregnancy.
11994274 report that autocrine hGH production by mammary carcinoma cells specifically results in the transcriptional repression of the p53-regulated placental transforming growth factor-beta gene (Placental growth factor-beta; TGF-beta)

AA Sequence

MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSF      1 - 70
LQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHL     71 - 140
KDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (43)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
26589570 2015 Lower levels of placental growth hormone in early pregnancy in women with type 1 diabetes and large for gestational age infants.
24035309 2013 Developmental programming of growth: genetic variant in GH2 gene encoding placental growth hormone contributes to adult height determination.
22489624 2012 Maternal serum placental growth hormone at 11-13 weeks' gestation in pregnancies delivering small for gestational age neonates.
22387044 2012 Differential placental expression profile of human Growth Hormone/Chorionic Somatomammotropin genes in pregnancies with pre-eclampsia and gestational diabetes mellitus.
22363400 2012 Maternal and fetal placental growth hormone and IGF axis in type 1 diabetic pregnancy.
20403354 2010 A population-based study of IGF axis polymorphisms and the esophageal inflammation, metaplasia, adenocarcinoma sequence.
20005926 2010 hGH-V gene expression and promoter activity under glucose and 5-azacytidine (5azaC) effects.
19844941 2009 Placental growth hormone and growth hormone binding protein are first trimester maternal serum markers of Down syndrome.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18473352 2008 Complex signatures of locus-specific selective pressures and gene conversion on Human Growth Hormone/Chorionic Somatomammotropin genes.
18356738 2008 Regulation of placental growth hormone secretion in a human trophoblast model--the effects of hormones and adipokines.
17701665 2007 Placental growth hormone is increased in the maternal and fetal serum of patients with preeclampsia.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15718272 2005 Stimulation of human trophoblast invasion by placental growth hormone.
15563602 2004 The high- and low-affinity receptor binding sites of growth hormone are allosterically coupled.
15531513 2004 Late life metabolic syndrome, early growth, and common polymorphism in the growth hormone and placental lactogen gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12946357 2003 The functional binding epitope of a high affinity variant of human growth hormone mapped by shotgun alanine-scanning mutagenesis: insights into the mechanisms responsible for improved affinity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213191 2002 Intracellular signaling by growth hormone variant (GH-V).
11994274 2002 Autocrine human growth hormone inhibits placental transforming growth factor-beta gene transcription to prevent apoptosis and allow cell cycle progression of human mammary carcinoma cells.
10393484 1999 Growth hormone heterogeneity in human pituitary and plasma.
9820620 1998 Complex alternative splicing of the GH-V gene in the human testis.
9709963 1998 Cloning of two novel growth hormone transcripts expressed in human placenta.
9367422 1997 Both pituitary and placental growth hormone transcripts are expressed in human peripheral blood mononuclear cells (PBMC).
8943276 1996 Crystal structure of an antagonist mutant of human growth hormone, G120R, in complex with its receptor at 2.9 A resolution.
7384802 1980 Genes for growth hormone, chorionic somatommammotropin, and growth hormones-like gene on chromosome 17 in humans.
7169009 1982 The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone.
7072716 1982 Chromosomal localization of the human placental lactogen-growth hormone gene cluster to 17q22-24.
6306568 1983 The human growth hormone gene family: structure and evolution of the chromosomal locus.
6286668 1982 Linkage arrangement of human placental lactogen and growth hormone genes.
6262212 1981 The genes for growth hormone and chorionic somatomammotropin are on the long arm of human chromosome 17 in region q21 to qter.
3379057 1988 Two distinct species of human growth hormone-variant mRNA in the human placenta predict the expression of novel growth hormone proteins.
2744760 1989 The human growth hormone locus: nucleotide sequence, biology, and evolution.
2460050 1988 Cloning and nucleotide sequence of placental hGH-V cDNA.
2196278 1990 Identification of placental human growth hormone as the growth hormone-V gene expression product.
1980158 1990 Hot spots for growth hormone gene deletions in homologous regions outside of Alu repeats.
1955498 1991 Binding of human growth hormone (GH)-variant (placental GH) to GH-binding proteins in human plasma.
1378436 1992 Developmental control and alternative splicing of the placentally expressed transcripts from the human growth hormone gene cluster.