Property Summary

NCBI Gene PubMed Count 17
PubMed Score 73.93
PubTator Score 12.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 6.7e-06
osteosarcoma -2.502 4.9e-04
adrenocortical carcinoma -1.575 5.5e-05
primary pancreatic ductal adenocarcinoma 1.637 3.3e-03
pilocytic astrocytoma 1.200 4.8e-05
pancreatic cancer 1.100 9.7e-03

Protein-protein Interaction (6)

Gene RIF (3)

PMID Text
25377544 Report different pattern of expression of GGT1 and GGT5 in normal human tissues.
24847614 There is a significant association of GGT with individual metabolic syndrome components, except HDL and inflammatory parameters (hs-CRP, ferritin).
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of gamma-glutamyltransferase 5 (GGT5) in primary human brain microvascular endothelial cells

AA Sequence

MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAILQQQGSPVDA      1 - 70
TIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPSLLDQCAQALPLGTGAQWIGV     71 - 140
PGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVLSRFLHNSILRPSLQASTLRQLFFNGTEPLR    141 - 210
PQDPLPWPALATTLETVATEGVEVFYTGRLGQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTL    211 - 280
YSPPPPAGGAILSFILNVLRGFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASR    281 - 350
DLLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT    351 - 420
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGA    421 - 490
GGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNV    491 - 560
VQAVSQEGACVYAVSDLRKSGEAAGY                                                561 - 586
//

Text Mined References (21)

PMID Year Title
25377544 2015 Immunolabeling of gamma-glutamyl transferase 5 in normal human tissues reveals that expression and localization differ from gamma-glutamyl transferase 1.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24847614 2014 Gamma-glutamyl transpeptidase level associated with metabolic syndrome and proinflammatory parameters in the young Roma population in eastern Slovakia: a population-based study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624525 2013 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.
21447318 2011 Gamma-glutamyl compounds: substrate specificity of gamma-glutamyl transpeptidase enzymes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18357469 2008 The human gamma-glutamyltransferase gene family.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11063908 2000 Evidence for the pro-oxidant effect of gamma-glutamyltranspeptidase-related enzyme.
10591208 1999 The DNA sequence of human chromosome 22.
10090893 1999 Low-copy repeats mediate the common 3-Mb deletion in patients with velo-cardio-facial syndrome.
9374738 1997 Expression and regulation of gamma-glutamyl transpeptidase-related enzyme in tracheal cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8095916 1993 Localization of a gamma-glutamyl-transferase-related gene family on chromosome 22.
6122208 1982 Interconversion of leukotrienes catalyzed by purified gamma-glutamyl transpeptidase: concomitant formation of leukotriene D4 and gamma-glutamyl amino acids.
1676842 1991 Identification of a human gamma-glutamyl cleaving enzyme related to, but distinct from, gamma-glutamyl transpeptidase.