Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1598.61
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
25280803 The serum GGT level was associated with brachial-ankle pulse wave velocity, a marker of peripheral atherosclerosis, independently of covariates including fatty liver or menopausal state just in women, but not in men.
25180444 In stable coronary artery disease, increased GGT activity within the normal range is associated with increased oxidative stress.
23682772 hGGT2 does not encode a functional enzyme; microarray data which have reported induction of hGGT2 mRNA should not be interpreted as induction of a protein that has a role in the metabolism of extracellular glutathione and in maintaining the redox status
23138005 In a Korean population, increased GGT serum concentration is associated with increased cardiovascular disease risk.
22749559 Fraction pattern analysis might increase the specificity of GGT as biomarker of alcohol abuse, especially in the context of differential diagnosis between alcoholism and non-alcoholic liver disease.
22269385 expression of GGT2 gene is closely regulated by the ERK signal pathway in 267B1/K-RAS cells.
21986103 High gamma-Glutamyltransferase is associated with arterial stiffness.
21375200 results indicate that levels of GGT were raised with increased waist girth, BMI, blood pressure TG and low HDL in patients with type 2 diabetes
20622017 Analysis of hepatic GGT glycopeptides revealed 11 glycan compositions, with 12 unique structures, none of which were observed on kidney GGT. Two glycosylation sites on renal GGT were modified exclusively by neutral glycans.
19670414 Ultrasonographic hepatic steatosis increases prediction of mortality risk from elevated serum gamma-glutamyl transpeptidase levels.
19214177 The association of serum gamma-glutamyltransferase (GGT) with body mass index and obesity is unrelated to the role of GGT in cysteine turnover.
19012630 Neither ALT nor GGT concentrations were correlated with ALP concentration, but AST concentration was moderately correlated with ALP concentration
18656271 GGT is confirmed an as independent risk factor in patients with established coronary artery disease.
18486136 Gamma-glutamyltransferase has a role in human atherosclerotic plaques
18421185 Plasma GGT activity might be a useful means to predict homocysteine concentration in the general population.
18342385 In subjects with a gamma-glutamyltransferase level of less than 40IU/L no difference was observed in the frequency of subjects with an fasting plasma glucose level of 110mg/dl or more.
18297606 These findings suggest that an ongoing redox imbalance, in terms of decreased plasma glutathione, is associated with raised GGT activity in subjects with a greater risk factor burden
18071669 Survey show relationships similar to those observed for GGT, including a powerful association with prevalent type 2 diabetes and organic pollutants.
17976673 Expression levels of GGT1 and possibly NFKBIE might be useful as biomarkers of genetic susceptibility to arsenite.

AA Sequence

MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAMAADAKQCLEIGRDTLRDGGSAVDAAIA      1 - 70
ALLCVGLMNAHSMGIGVGLFLTIYNSTTGKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRG     71 - 140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLWYVFCRDRKVLREGERLTL    141 - 210
PRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAR    211 - 280
LSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF    281 - 350
AAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNE    351 - 420
WTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLW    421 - 490
FGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDS    491 - 560
RKGGEPAGY                                                                 561 - 569
//

Text Mined References (25)

PMID Year Title
25280803 2014 Association between serum ?-glutamyltranspeptidase and atherosclerosis: a population-based cross-sectional study.
25180444 2015 Gamma glutamyl transferase activity is independently associated with oxidative stress rather than SYNTAX score.
23682772 2013 Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23138005 2012 Serum gamma-glutamyltransferase as a risk factor for general cardiovascular disease prediction in Koreans.
22749559 2013 High-sensitivity ?-glutamyltransferase fraction pattern in alcohol addicts and abstainers.
22269385 2012 K-RAS transformation in prostate epithelial cell overcomes H2O2-induced apoptosis via upregulation of gamma-glutamyltransferase-2.
21986103 2012 Association between ?-glutamyltransferase, adiponectin and arterial stiffness.
21375200 2010 Comparison of gamma glutamyltransferase in normal and in type 2 diabetics.
20622017 2010 Analysis of site-specific glycosylation of renal and hepatic ?-glutamyl transpeptidase from normal human tissue.
19670414 2009 Ultrasonographic hepatic steatosis increases prediction of mortality risk from elevated serum gamma-glutamyl transpeptidase levels.
19214177 2009 The association of plasma cysteine and gamma-glutamyltransferase with BMI and obesity.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19012630 2008 The population distributions, upper normal limits and correlations between liver tests among Australian adolescents.
18656271 2009 Additive prognostic value of gamma-glutamyltransferase in coronary artery disease.
18486136 2009 Gamma-glutamyltransferase activity in human atherosclerotic plaques--biochemical similarities with the circulating enzyme.
18421185 2008 Plasma gamma-glutamyl transferase activity predicts homocysteine concentration in a large cohort of unselected outpatients.
18357469 2008 The human gamma-glutamyltransferase gene family.
18342385 2008 Relationship between response of gamma-glutamyltransferase to alcohol consumption and levels of fasting plasma glucose.
18297606 2008 Plasma glutathione levels are independently associated with gamma-glutamyltransferase activity in subjects with cardiovascular risk factors.
18071669 2008 Can persistent organic pollutants explain the association between serum gamma-glutamyltransferase and type 2 diabetes?
17976673 2008 Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility.
10591208 1999 The DNA sequence of human chromosome 22.
8104871 1993 Mapping of human gamma-glutamyl transpeptidase genes on chromosome 22 and other human autosomes.
2573352 1989 Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.