Property Summary

NCBI Gene PubMed Count 161
PubMed Score 1697.41
PubTator Score 467.97

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (109)

PMID Text
26863311 gamma-Glutamyltransferase is an independent risk factor for breast cancer beyond the consumption of alcohol and other life style risk factors
26463174 macrophages characterized by a pro-inflammatory phenotype may contribute to intra-plaque accumulation of b-GGT, with role in the progression of atherosclerosis
26414209 Elevated serum GGT levels are independently associated with coronary artery calcification progression
26252286 High serum GGT levels were an independent risk factor for all-cause mortality in peritoneal dialysis patients.
26175398 serum GGT and LDH together with higher BCLC staging should be potential predictive factors for HCC overall survival.
26152752 There were similar hazards for all-cause and cancer mortality and attenuated hazards for cardiovascular mortality for people in the highest GGT quartile, adjusting for fatty liver assessed by either ultrasound or fatty liver index.
26013825 report crystal structures that show conformational changes within the active site as the enzyme progresses from the free enzyme to inhibitor-bound tetrahedral transition states and to a glutamate-bound structure prior to release of final reaction product
25952030 Interactive effects of GGT1 G allele and low HDL-cholesterol level on diabetic angiopathy is identified.
25913781 Elevated serum GGT activity was independently associated with sarcopenia and sarcopenic obesity in community-dwelling older adults.
25500578 Serum GGT level is associated with urinary albumin excretion in middle-aged and elderly Chinese.
25437895 elevated serum ALT and GGT levels are associated with increased arterial stiffness, independent of the classical atherosclerotic risk factors in Japanese men
25377544 Report different pattern of expression of GGT1 and GGT5 in normal human tissues.
25372290 the SOD2 Val16Ala polymorphism has an impact on the relationship between VPA exposure and gamma-GT elevation in patients with epilepsy. These results suggest that determining the SOD2 genotype could be helpful for preventing the VPA-induced gamma-GT elevation.
25299965 intra-plaque b-GGT activity correlates with the histological markers of vulnerable plaque and with plasma b-GGT in human carotid atherosclerosis
25282687 serum gamma-glutamyltransferase does not seem to be associated with carotid atherosclerosis
25280803 The serum GGT level was associated with brachial-ankle pulse wave velocity, a marker of peripheral atherosclerosis, independently of covariates including fatty liver or menopausal state just in women, but not in men.
25180444 In stable coronary artery disease, increased GGT activity within the normal range is associated with increased oxidative stress.
25043373 High Gamma glutamyltransferase expression is associated with the risk of cancer.
24813308 In Koreans after adjusting for confounders and combination of GGT and UA levels can have a strong synergy in predicting the development of coronary heart disease.
24780890 The study showed a positive correlation between serum GGT and coronary artery disease in a Chinese population.
24748164 High serum GGT levels are associated with recurrence in hepatocellular carcinoma.
24613362 The incidence of hepatocellular carcinoma (HCC) did not differ between patients with high and low baseline gammaGT levels in patients with cirrhosis, but incidence of HCC was higher in non-cirrhotic patients with high gammaGT levels vs those with low gammaGT levels.
24572983 results suggest that serum beta2M and GGT levels are useful indicators for evaluating the occurrence of slight inflammation as background, which promotes atherosclerosis even in healthy children.
24533866 key enzyme involved in the biosynthesis of Cys-Gly-3-methyl-3-sulfanylhexanol
24533101 b-GGT is constituted of membrane microvesicles in both bile and plasma, m-GGT and s-GGT might be constituted of bile-acid micelles, while f-GGT represents the free-soluble form of the enzyme
24326630 Hepatic 2-deoxy-2-((18)F)fluoro-D-glucose uptake is closely associated with elevated triglyceride and GGT regardless of the presence of fatty liver disease. Thus, inflammation response may play a major role in increased hepatic glucose uptake.
24120856 The epidemiological association of alcohol intake with GGT is partly explained by genetic pleiotropy in this healthy population sample.
24047895 The hGGT1 structure also revealed tightly bound chlorides near the catalytic residue that may contribute to catalytic activity. These are absent in the bacterial GGTs.
24044563 GGT is strongly associated with both cardiovascular and metabolic risk factors
23736697 The data underscores the role of ethanol consumption and age as major determinants of increased GGT levels in men, whereas in women, a relatively stronger impact was noted for ethanol intake and body mass index.
23697277 COPD patients present higher serum CRP and GGT values than healthy subjects independently from their smoking habits
23667618 Alcohol consumption, smoking status, and metabolic syndrome impact on serum levels of aspartate aminotransferase (AST), alanine aminotransferase (ALT), and gamma-glutamyl transferase (GGT), was determined.
23462328 Results suggest that common variation in the GGT1 gene may affect risk of chronic pancreatitis.
23448276 These data strongly indicate a discrepancy between the regulation of GCLC and of GGT following the oxidative stress situation due to mitochondrial uncoupling.
23295001 Elevated level of GGT was associated with endometrial cancer.
23249638 Generation of reactive oxygen species by the gamma-Glutamyltransferase/glutathione/transferrin system can modify the platelets' redox environment and induce apoptosis in in vitro conditions.
23227248 In patients with chronic liver diseases, insulin resistance is independently linked to liver fibrosis only in patients with abnormal gamma-GT values.
23178147 The correlation of serum IL-33 levels with GGT levels may provide a novel marker for the diagnosis of biliary atresia.
23096761 relationship among lung function, metabolic profile and serum CGT level
23000601 GGT was independently associated with increased arterial stiffness both in men and in women with established coronary artery disease.
22906265 Levels of GGT in fatty liver patients may compensate for mild oxidative stress by repressing 8-OHdG levels and preventing progression to NASH; however further oxidative stress leads to increased levels of 8-OHdG and the development of NASH
22498419 A significant correlation was found between serum GGT levels and coronary artery calcification and coronary heart disease risk factors.
22424154 In a series of patients with normal or mild elevation of gamma-GT, the severity of hepatic steatosis does not entail higher carotid intima-media thickness.
22334565 serum GGT may represent a link between fatty liver and the development of early atherosclerosis.
22315051 High serum gamma-glutamyltransferase is associated with endometrial cancer.
22267845 echocardiographic epicardial adipose tissue (EAT) was significantly higher in patients with coronary artery disease and serum GGT activity correlated with EAT thickness.
22266633 when GGT was higher than 20 U/l, the risk of developing prehypertension increased
22132177 The patterns of interaction between smoking and alcohol consumption or BMI with respect to AST and ALT resembled those observed for gamma-GT.
22010049 Pathway analysis of significant and suggestive single-nucleotide polymorphism associations showed significant overlap between genes affecting GGT and those affecting common metabolic and inflammatory diseases
21712391 co-translational N-glycosylation of human GGT is required for the proper folding
21521327 Results suggest that GGT is independently associated with the increased level of arterial stiffness both in men and in women and the association between them appears to be stronger in men compared to women.
21512179 Data suggest that in men with above-normal serum gamma-glutamyltransferase levels, even light-to-moderate alcohol consumption could be a risk factor for ischemic stroke.
21221836 Serum gamma-glutamyl transferase was associated with intra-erythrocyte magnesium in obese children and adolescents, independently of body mass index and HOMA-IR.
21199427 Study confirmed significant and independent associations of GGT and ALT with MetS in adult Chinese people.
21125972 GGT levels may play a role in pathogenesis of microvascular atherosclerotic process cardiac syndrome x.
21044991 gamma-glutamyltransferase 1 causal relation found for blood insulin levels but not blood pressure
21029002 increased GGT levels are associated with impaired aortic elasticity in patients with prehypertension.
20972737 liver enzymes, including GGT, were significantly associated with IR according to direct clamp assessment, which were independent of the traditional risk factors in diabetic patients
20934730 The present results show that circulating IL-1beta and IL-6 concentrations are strongly and independently associated with gamma-GTP activity in middle-aged Japanese men without obvious cardiovascular diseases.
20850749 Accumulation of GGT activity inside the lipid component of valves leaflets suggests a common mechanism of lesion shaping underlying both atherosclerosis and degenerative aortic valve disease.
20691173 Total and fractional GGT values among patients with myotonic dystrophy type-1 or liver disease (LD) and healthy subjects (HS), were compared.
20648472 Observational study of gene-disease association. (HuGE Navigator)
20625912 Serum GGT levels were higher in acute coronary syndrome patients but there was no difference between diabetic and non-diabetic subgroups.
20538960 Observational study of gene-disease association. (HuGE Navigator)
20484958 Lead SNP rs4820599 is in high linkage disequilibrium (LD; pairwise r(2): 0.69) and tagSNP rs2017869 is in strong LD (pairwise r(2): 0.96) with SNP rs5751901, which has been reported to be associated with increased GGT1 serum levels in pancreatic cancer.
20484958 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20452593 PCSK9 has a role in regulating GGT level in diabetic patients, suggesting potential interaction between PCSK9 and liver function
20404051 gamma-glutamyltransferase may have a role in incidence of type 2 diabetes in Japan
20205615 The association of coffee and green tea consumption with serum activities of liver enzymes in free-living Japanese men and women was examined, focusing on sex difference and effect modifications of alcohol and obesity.
20129611 Plasma bilirubin and gamma-glutamyltransferase activity are inversely related in dyslipidemic patients with metabolic syndrome
20092819 Gamma-glutamyltransferase has a role in coronary heart disease
20090360 there was no association between increasing levels of serum GGT and chronic kidney disease in a sample of US adults
19896490 Observational study of gene-disease association. (HuGE Navigator)
19863187 Data show that the b-GGT present in human plasma can be produced by tissues other than the liver, thus explaining the increase of serum GGT observed in diseases of other organs.
19695568 Serum gamma-glutamyl transferase may have a role in mortality in persons undergoing coronary angiography
19148121 Central obesity and metabolic syndrome were associated with elevated levels of gamma-glutamyltransferase.
19057528 As serum gamma-glutamyltransferase concentration increased, the association of body mass index with atherogenic dyslipidemia and glycemic control strengthened.
19034330 High gamma-glutamyltransferase in end-stage renal disease patients is a strong, independent risk marker for all cause and cardiovascular death.
18987455 These results suggest that higher serum GGT levels are associated with prehypertension or hypertension in the general male population.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18715564 gamma-glutamyltransferase is not associated with peripheral arterial disease in type 2 diabetic patients
18708042 Alanine aminotransferase, alanine/aspartate aminotransferase ratio, and gamma-glutamyl transferase are associated with the MetS but not with angiographically determined coronary atherosclerosis.
18483283 gamma-glutamyltransferase may have a role in risk of cancer incidence in men
18464913 Observational study of gene-disease association. (HuGE Navigator)
18441507 the presence of diabetes mellitus may attenuate the effects of GGT on blood pressure in hypertensive patients
18242760 Data revealed higher gamma-glutamyltranspeptidase for women with a family history of diabetes, when adjusted for age and BMI.
18037420 There was a positive association between serum GGT level and peripheral artery disease among men, particularly non-Hispanic white and nondrinker men, but not among women
17965490 Serum GGT may be an additional marker of arterial stiffness, especially in men, though the relationship with arterial stiffness was very weak.
17895524 The results indicate that "silent" apoptosemia occurs in T1 and T2 diabetic children and suggest elevated GGT in diabetic children could be due to release from apoptotic cells
17698237 Association between the serum level parameters of adiposity and lipid profile.
17652002 Modest elevation of GGT observed in overweight children may be of pathophysiological importance in the long term
17601350 Observational study of gene-disease association. (HuGE Navigator)
17503391 GGT1 is a biological tumor marker for epithelial ovarian cancers.
17260973 In contrast to the E Coli GGT1, in the human enzyme, a specific residue in the Cys-Gly binding site played a critical role in recognizing the Cys-Gly moiety or the acceptor molecules by interacting with the C-terminal carboxy group
17141888 The role of high gammaGT activity in HepG2 cells can be connected with production of reactive oxygen species and with S-thiolation with Cys and Cys-Gly that can influence activity of caspase 3.
17109502 The biliary IL-6 and TNF-alpha levels were positively correlated with serum DBIL, TBA and gamma-GT levels in infantile hepatitis syndrome subjects.
17095717 An increase in serum GGT predicts onset of metabolic syndrome, incident CVD, and death suggesting that GGT is a marker of metabolic and cardiovascular risk.
16386375 Transfection of activated Ras in human colon carcinoma cell line expressing wild-type Ras resulted in increased GGT, while reduced enzyme level was found in another cell line with constitutive Ras after transfection with dominant-negative Ras mutant.
15694941 After adjustment for race, sex, age, cigarette smoking, alcohol intake, and body mass index (BMI), serum concentration of GGT across all deciles was positively associated with serum concentrations of CRP.
15528049 Membrane GGT activity-often expressed at high levels in human malignancies-can oxidize extracellular AA and promote its uptake efficiently.
15052692 Metabolic syndrome seemed to be directly, not indirectly through fatty liver, associated with the raised GGT level in Japanese women. No significant association between the raised GGT level and the presence of fatty liver.
14754911 there is a complete deficiency of LTD(4) biosynthesis in patients with a genetic deficiency of GGT which represents a new inborn error of cysteinyl leukotriene synthesis
12835487 The gamma-glutamyl transpeptidase activity in both oligoasthenospermic and azoospermic subjects were significantly lower than in asthenospermic and oligospermic individuals
12532447 Gamma-glutamyl transpeptidase gene expression in liver, liver disease, and liver neoplasms.
12480555 Glucose intolerance is associated with elevated serum aminotransferase independent of obesity.
12447480 Malignant lung tumors (squamous cell carcinoma and adenocarcinoma) had significantly increased levels of this enzyme.
12030366 Gamma-glutamyl transpeptidase activity mediates NF-kappaB activation through lipid peroxidation in human leukemia U937 cells.
11940314 explore the relationship between the alteration in gamma-glutamyl transpeptidase (GGT) mRNA expression and the development of hepatocellular carcinoma (HCC)

AA Sequence

MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIA      1 - 70
ALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRG     71 - 140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTL    141 - 210
PQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAP    211 - 280
LSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF    281 - 350
AAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE    351 - 420
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLW    421 - 490
FGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDS    491 - 560
RKGGEPAGY                                                                 561 - 569
//

Text Mined References (162)

PMID Year Title
26863311 2016 ?-Glutamyltransferase and Breast Cancer Risk Beyond Alcohol Consumption and Other Life Style Factors - A Pooled Cohort Analysis.
26463174 2015 Monocytes/macrophages activation contributes to b-gamma-glutamyltransferase accumulation inside atherosclerotic plaques.
26414209 2015 Association between serum gamma-glutamyltransferase and the progression of coronary artery calcification.
26252286 2015 Serum Gamma-Glutamyltransferase Levels Predict Mortality in Patients With Peritoneal Dialysis.
26175398 2015 Elevation of serum GGT and LDH levels, together with higher BCLC staging are associated with poor overall survival from hepatocellular carcinoma: a retrospective analysis.
26152752 2015 ?-Glutamyl Transferase Is Associated with Mortality Outcomes Independently of Fatty Liver.
26013825 2015 Human ?-Glutamyl Transpeptidase 1: STRUCTURES OF THE FREE ENZYME, INHIBITOR-BOUND TETRAHEDRAL TRANSITION STATES, AND GLUTAMATE-BOUND ENZYME REVEAL NOVEL MOVEMENT WITHIN THE ACTIVE SITE DURING CATALYSIS.
25952030 2015 Interactive effects of a common ?-glutamyltransferase 1 variant and low high-density lipoprotein-cholesterol on diabetic macro- and micro-angiopathy.
25913781 2015 Gamma-glutamyl transferase is associated with sarcopenia and sarcopenic obesity in community-dwelling older adults: results from the Fifth Korea National Health and Nutrition Examination Survey, 2010-2011.
25500578 2014 Serum gamma - glutamyltransferase is associated with albuminuria: a population-based study.
25437895 2015 Relationships of elevated levels of serum hepatic enzymes and alcohol intake with arterial stiffness in men.
25377544 2015 Immunolabeling of gamma-glutamyl transferase 5 in normal human tissues reveals that expression and localization differ from gamma-glutamyl transferase 1.
25372290 2014 Impact of the superoxide dismutase 2 Val16Ala polymorphism on the relationship between valproic acid exposure and elevation of ?-glutamyltransferase in patients with epilepsy: a population pharmacokinetic-pharmacodynamic analysis.
25299965 2014 b-Gamma-glutamyltransferase activity in human vulnerable carotid plaques.
25282687 2014 Lack of association between serum gamma-glutamyltransferase and carotid atherosclerosis: the Namwon Study.
25280803 2014 Association between serum ?-glutamyltranspeptidase and atherosclerosis: a population-based cross-sectional study.
25180444 2015 Gamma glutamyl transferase activity is independently associated with oxidative stress rather than SYNTAX score.
25043373 2015 Gamma glutamyltransferase, alanine aminotransferase and risk of cancer: systematic review and meta-analysis.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24813308 2014 Combined effect of serum gamma-glutamyltransferase and uric acid on Framingham risk score.
24780890 2014 Serum gamma-glutamyl transferase: a novel biomarker for coronary artery disease.
24748164 2014 ?-Glutamyltranspeptidase is a prognostic marker of survival and recurrence in radiofrequency-ablation treatment of hepatocellular carcinoma.
24613362 2014 Baseline gamma-glutamyl transferase levels strongly correlate with hepatocellular carcinoma development in non-cirrhotic patients with successful hepatitis C virus eradication.
24572983 2014 Relationships of gamma-glutamyltransferase and beta 2-microglobulin on high sensitivity C-reactive protein among Japanese elementary school children.
24533866 2014 Glutathione-conjugated sulfanylalkanols are substrates for ABCC11 and ?-glutamyl transferase 1: a potential new pathway for the formation of odorant precursors in the apocrine sweat gland.
24533101 2014 Gamma-glutamyltransferase fractions in human plasma and bile: characteristic and biogenesis.
24326630 2014 Hepatic glucose uptake is increased in association with elevated serum ?-glutamyl transpeptidase and triglyceride.
24120856 2014 The association of alcohol intake with ?-glutamyl transferase (GGT) levels: evidence for correlated genetic effects.
24047895 2013 Novel insights into eukaryotic ?-glutamyltranspeptidase 1 from the crystal structure of the glutamate-bound human enzyme.
24044563 2013 Associations between total serum GGT activity and metabolic risk: MESA.
23736697 2013 Individual and joint impacts of ethanol use, BMI, age and gender on serum gamma-glutamyltransferase levels in healthy volunteers.
23697277 2013 Gamma-glutamyltransferase and C-reactive protein in stable chronic obstructive pulmonary disease.
23682772 2013 Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.
23667618 2013 Independent and supra-additive effects of alcohol consumption, cigarette smoking, and metabolic syndrome on the elevation of serum liver enzyme levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23462328 2013 Variation in the ?-glutamyltransferase 1 gene and risk of chronic pancreatitis.
23448276 2013 Differential regulation of ?-glutamyltransferase and glutamate cysteine ligase expression after mitochondrial uncoupling: ?-glutamyltransferase is regulated in an Nrf2- and NF?B-independent manner.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23295001 2013 Lifestyle-related biomarkers and endometrial cancer survival: elevated gamma-glutamyltransferase as an important risk factor.
23249638 2012 Influence of platelet ?-glutamyltransferase on oxidative stress and apoptosis in the presence of holo-transferrin.
23227248 2012 Serum ?-glutamyl transferase levels, insulin resistance and liver fibrosis in patients with chronic liver diseases.
23178147 2013 Interleukin-33 overexpression is associated with gamma-glutamyl transferase in biliary atresia.
23096761 2012 Association between serum ?-glutamyltransferase and pulmonary dysfunction.
23000601 2013 Association of serum gamma-glutamyltransferase with arterial stiffness in established coronary artery disease.
22906265 2012 Levels of the oxidative stress marker ?-glutamyltranspeptidase at different stages of nonalcoholic fatty liver disease.
22498419 2013 Association between gamma-glutamyltransferase and coronary artery calcification.
22424154 2012 Are hepatic steatosis and carotid intima media thickness associated in obese patients with normal or slightly elevated gamma-glutamyl-transferase?
22334565 2012 Fatty liver index, gamma-glutamyltransferase, and early carotid plaques.
22315051 2012 Prognostic significance of gamma-glutamyltransferase in patients with endometrial cancer: a multi-centre trial.
22267845 2013 Serum ?-glutamyltransferase levels correlate with epicardial adipose tissue thickness in patients with coronary artery disease.
22266633 2012 Association between ?-glutamyltransferase and prehypertension.
22132177 2011 Liver enzymes: interaction analysis of smoking with alcohol consumption or BMI, comparing AST and ALT to ?-GT.
22010049 2012 Loci affecting gamma-glutamyl transferase in adults and adolescents show age × SNP interaction and cardiometabolic disease associations.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21712391 2011 Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.
21521327 2011 Serum gamma-glutamyltransferase is associated with arterial stiffness in healthy individuals.
21512179 2011 Association with serum gamma-glutamyltransferase levels and alcohol consumption on stroke and coronary artery disease: the Suita study.
21221836 2011 Intra-erythrocyte magnesium is associated with gamma-glutamyl transferase in obese children and adolescents.
21199427 2011 Cross-sectional and longitudinal association of serum alanine aminotransaminase and ?-glutamyltransferase with metabolic syndrome in middle-aged and elderly Chinese people.
21125972 2010 Elevated serum gamma-glutamyl transferase activity in patients with cardiac syndrome X and its relationship with carotid intima media thickness.
21044991 2010 Use of a Mendelian randomization approach to assess the causal relation of gamma-Glutamyltransferase with blood pressure and serum insulin levels.
21029002 2010 The relationship of gamma-glutamyltransferase to aortic elastic properties in young patients with prehypertension.
20972737 2010 Positive correlations of liver enzymes with metabolic syndrome including insulin resistance in newly diagnosed type 2 diabetes mellitus.
20934730 2011 Circulating interleukin-1? and interleukin-6 concentrations are closely associated with ?-glutamyltranspeptidase activity in middle-aged Japanese men without obvious cardiovascular diseases.
20850749 2010 Aortic valve disease and gamma-glutamyltransferase: accumulation in tissue and relationships with calcific degeneration.
20691173 2010 Serum gamma-glutamyltransferase fractions in myotonic dystrophy type I: differences with healthy subjects and patients with liver disease.
20648472 2010 PNPLA3 variants specifically confer increased risk for histologic nonalcoholic fatty liver disease but not metabolic disease.
20625912 2013 GGT levels in type II diabetic patients with acute coronary syndrome (does diabetes have any effect on GGT levels in acute coronary syndrome?).
20622017 2010 Analysis of site-specific glycosylation of renal and hepatic ?-glutamyl transpeptidase from normal human tissue.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20484958 2010 Pooling-based genome-wide association study implicates gamma-glutamyltransferase 1 (GGT1) gene in pancreatic carcinogenesis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20452593 2010 Association between plasma PCSK9 and gamma-glutamyl transferase levels in diabetic patients.
20404051 2010 Association of gamma-glutamyltransferase with incidence of type 2 diabetes in Japan.
20205615 2010 Relation of coffee consumption and serum liver enzymes in Japanese men and women with reference to effect modification of alcohol use and body mass index.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20129611 2010 Plasma bilirubin and gamma-glutamyltransferase activity are inversely related in dyslipidemic patients with metabolic syndrome: relevance to oxidative stress.
20092819 2010 Gamma-glutamyltransferase and prognosis in patients with stable coronary heart disease followed over 8 years.
20090360 2010 Association between serum gamma-glutamyltransferase and chronic kidney disease among US adults.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19863187 2009 Cultured human cells release soluble gamma-glutamyltransferase complexes corresponding to the plasma b-GGT.
19695568 2010 Serum gamma-glutamyl transferase and mortality in persons undergoing coronary angiography-The Ludwigshafen Risk and Cardiovascular Health Study.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19148121 2009 gamma-Glutamyltransferase, obesity, physical activity, and the metabolic syndrome in indigenous Australian adults.
19057528 2009 Relationship of serum gamma-glutamyltransferase to atherogenic dyslipidemia and glycemic control in type 2 diabetes.
19034330 2008 Gammaglutamyltransferase in ESRD as a predictor of all-cause and cardiovascular mortality: another facet of oxidative stress burden.
18987455 2008 Association between serum gamma-glutamyl transferase level and prehypertension among community-dwelling men.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18715564 2009 Serum gamma-glutamyltransferase is not associated to peripheral arterial disease in type 2 diabetic patients: Cross-sectional findings.
18708042 2008 Alanine aminotransferase and gamma-glutamyl transferase are associated with the metabolic syndrome but not with angiographically determined coronary atherosclerosis.
18483283 2008 Association of gamma-glutamyltransferase and risk of cancer incidence in men: a prospective study.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18441507 2008 The association between an increased level of gamma-glutamyl transferase and systolic blood pressure in diabetic subjects.
18357469 2008 The human gamma-glutamyltransferase gene family.
18242760 2008 Elevated liver enzymes in women with a family history of diabetes.
18037420 2008 Serum gamma-glutamyltransferase level and peripheral arterial disease.
17965490 2007 Can gamma-glutamyltransferase be an additional marker of arterial stiffness?
17924658 2007 Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.
17895524 2007 Plasma levels of cell-free apoptotic DNA ladders and gamma-glutamyltranspeptidase (GGT) in diabetic children.
17698237 2008 Hepatic fat content-independent association of the serum level of gamma-glutamyltransferase with visceral adiposity, but not subcutaneous adiposity.
17652002 2007 Relationship between gamma-glutamyltransferase and fat mass in a general population of 8-17 years old children. The FLVS II study.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17503391 2006 Biomarkers for epithelial ovarian cancers.
17260973 2007 Design, synthesis, and evaluation of gamma-phosphono diester analogues of glutamate as highly potent inhibitors and active site probes of gamma-glutamyl transpeptidase.
17141888 2007 The effects of modulation of gamma-glutamyl transpeptidase activity in HepG2 cells on thiol homeostasis and caspase-3-activity.
17109502 2006 Alterations of biliary biochemical constituents and cytokines in infantile hepatitis syndrome.
17095717 2007 Gamma glutamyl transferase and metabolic syndrome, cardiovascular disease, and mortality risk: the Framingham Heart Study.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16386375 2006 Radiation-induced upregulation of gamma-glutamyltransferase in colon carcinoma cells is mediated through the Ras signal transduction pathway.
15694941 2005 Association between serum gamma-glutamyltransferase and C-reactive protein.
15528406 2004 Hemoxygenase-2 is an oxygen sensor for a calcium-sensitive potassium channel.
15528049 2004 Plasma membrane gamma-glutamyltransferase activity facilitates the uptake of vitamin C in melanoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15084671 2004 A proteomic analysis of human bile.
15052692 2004 Metabolic syndrome is directly associated with gamma glutamyl transpeptidase elevation in Japanese women.
14754911 2004 Synthesis and metabolism of leukotrienes in gamma-glutamyl transpeptidase deficiency.
12835487 2003 Correlation of trace mineral concentrations with fructose, gamma-glutamyl transpeptidase, and acid phosphatase in seminal plasma of different categories of infertile men.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12532447 2003 The analysis of gamma-glutamyl transpeptidase gene in different type liver tissues.
12480555 2003 Glucose intolerance and serum aminotransferase activities in Japanese men.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447480 2002 Activity of glutathione-metabolizing and antioxidant enzymes in malignant and benign tumors of human lungs.
12144532 2002 Erythrocytes as targets for gamma-glutamyltranspeptidase initiated pro-oxidant reaction.
12030366 2002 Gamma-glutamyl transpeptidase activity mediates NF-kappaB activation through lipid peroxidation in human leukemia U937 cells.
11940314 2002 [The value of gamma-glutamyl transpeptidase mRNA typing in monitoring carcinogensis of heptocytes].
10756096 2000 Statistical analysis of the 5' untranslated region of human mRNA using "Oligo-Capped" cDNA libraries.
10591208 1999 The DNA sequence of human chromosome 22.
10392451 1999 Gamma-glutamyl transpeptidase gene organization and expression: a comparative analysis in rat, mouse, pig and human species.
9862348 1998 Gamma-glutamyl transpeptidase, an ecto-enzyme regulator of intracellular redox potential, is a component of TM4 signal transduction complexes.
9738450 1998 An intronic promoter controls the expression of truncated human gamma-glutamyltransferase mRNAs.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8827453 1996 Effects of substitutions of the conserved histidine residues in human gamma-glutamyl transpeptidase.
8519693 1995 Inhibition of gamma-glutamyl transpeptidase activity at the surface of human myeloid cells is correlated with macrophage maturation and transforming growth factor beta production.
8104871 1993 Mapping of human gamma-glutamyl transpeptidase genes on chromosome 22 and other human autosomes.
8104826 1993 The 5' untranslated region of the human gamma-glutamyl transferase mRNA contains a tissue-specific active translational enhancer.
8095045 1993 Significance of Arg-107 and Glu-108 in the catalytic mechanism of human gamma-glutamyl transpeptidase. Identification by site-directed mutagenesis.
7906515 1994 Expression of multiple gamma-glutamyltransferase genes in man.
7759490 1995 Human gamma-glutamyl transpeptidase mutants involving conserved aspartate residues and the unique cysteine residue of the light subunit.
7689219 1993 Human lung expresses unique gamma-glutamyl transpeptidase transcripts.
7673200 1995 Involvement of Ser-451 and Ser-452 in the catalysis of human gamma-glutamyl transpeptidase.
2907498 1988 The primary structure of human gamma-glutamyl transpeptidase.
2904146 1988 Cloning and nucleotide sequence of human gamma-glutamyl transpeptidase.
2901712 1988 Duplication of the bcr and gamma-glutamyl transpeptidase genes.
2900635 1988 In vitro translation and processing of human hepatoma cell (Hep G2) gamma-glutamyl transpeptidase.
2898474 1988 gamma-Glutamyl transpeptidase: a single copy gene in the rat and a multigene family in the human genome.
2896486 1988 Renal gamma-glutamyl transpeptidases: structural and immunological studies.
2885259 1987 Assignment of the human gamma-glutamyl transferase gene to the long arm of chromosome 22.
2869484 1986 Molecular cloning and nucleotide sequence of rat kidney gamma-glutamyl transpeptidase cDNA.
2573352 1989 Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.
2568315 1989 Human gamma-glutamyl transpeptidase cDNA: comparison of hepatoma and kidney mRNA in the human and rat.
2563599 1989 Regulation of the expression of some genes for enzymes of glutathione metabolism in hepatotoxicity and hepatocarcinogenesis.
1968061 1990 An alternatively processed mRNA specific for gamma-glutamyl transpeptidase in human tissues.
1378736 1992 Gamma-glutamyltransferase: nucleotide sequence of the human pancreatic cDNA. Evidence for a ubiquitous gamma-glutamyltransferase polypeptide in human tissues.
28899 1977 Cytoplasmic gamma-glutamyltransferase: isolation, product formation and physiological role.
19463 1977 Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.
18198 1977 Partial purification and some properties of gamma-glutamyl transpeptidase from human bile.