Property Summary

NCBI Gene PubMed Count 10
PubMed Score 30.26
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.188 8.0e-06
astrocytic glioma -1.100 2.9e-02
dermatomyositis 1.200 2.8e-04
hepatocellular carcinoma -1.100 1.7e-02
intraductal papillary-mucinous adenoma (... 1.100 8.0e-03
Multiple myeloma 1.124 3.6e-02
non primary Sjogren syndrome sicca -1.200 1.9e-02
oligodendroglioma -1.100 4.0e-02
osteosarcoma -1.970 9.5e-08
ovarian cancer -1.500 1.8e-05
pancreatic ductal adenocarcinoma liver m... 1.138 1.2e-02
Rheumatoid arthritis 1.800 3.7e-02
tuberculosis 1.400 2.1e-04

Gene RIF (5)

AA Sequence

MARLVAVCRDGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSI      1 - 70
AMVVTSREVLSALSQLVPCVGCRRSVERLFSQLVESGNPALEPLTVGPKGVLSVTRSCMTDAKKLYTLFY     71 - 140
VHGSKLNDMIDAIPKSKKNKRCQLHSLDTHKPKPLGGCWMDVWELMSQECRDEVVLIDSSCLLETLETYL    141 - 210
RKHRFCTDCKNKVLRAYNILIGELDCSKEKGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFA    211 - 280
GGRRERHAKTIDIAQEEVLTCLGIHLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVQGIS    281 - 350
RLEQLCEEFSEEERVRELKQEKKRQKRKNRRKNKCVCDIPTPLQTADEKEVSQEKETDFIENSSCKACGS    351 - 420
TEDGNTCVEVIVTNENTSCTCPSSGNLLGSPKIKKGLSPHCNGSDCGYSSSMEGSETGSREGSDVACTEG    421 - 490
ICNHDEHGDDSCVHHCEDKEDDGDSCVECWANSEENDTKGKNKKKKKKSKILKCDEHIQKLGSCITDPGN    491 - 560
RETSGNTMHTVFHRDKTKDTHPESCCSSEKGGQPLPWFEHRKNVPQFAEPTETLFGPDSGKGAKSLVELL    561 - 630
DESECTSDEEIFISQDEIQSFMANNQSFYSNREQYRQHLKEKFNKYCRLNDHKRPICSGWLTTAGAN       631 - 697
//

Text Mined References (13)

PMID Year Title