Property Summary

NCBI Gene PubMed Count 61
PubMed Score 256.08
PubTator Score 118.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis -1.403 2.4e-02
Multiple myeloma 1.890 4.4e-02
malignant mesothelioma -1.800 1.3e-07
astrocytic glioma -1.200 1.8e-02
psoriasis 2.300 1.8e-18
posterior fossa group A ependymoma 1.600 6.2e-08
ulcerative colitis -1.332 1.4e-02
adrenocortical carcinoma 2.509 4.6e-06
pancreatic ductal adenocarcinoma liver m... -3.310 5.5e-04
non-small cell lung cancer 2.151 3.2e-18
intraductal papillary-mucinous adenoma (... -1.700 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.3e-02
lung cancer 7.000 2.6e-08
atypical teratoid/rhabdoid tumor 1.300 4.0e-04
group 3 medulloblastoma 1.200 2.9e-02
Endometriosis 1.663 1.6e-02
invasive ductal carcinoma 1.500 1.5e-02
ovarian cancer 2.000 2.3e-03
pituitary cancer 1.300 3.1e-03

Protein-protein Interaction (8)

Gene RIF (46)

PMID Text
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
25823786 This study shows that polymorphisms on genes related to the metabolic pathway of pemetrexed, especially, ATIC and GGH genes, would have a therapeutic implication in pemetrexed-treated patients with lung adenocarcinoma
24908438 Polymorphism of GGH rs3758149 C>T is associated with response to therapy in acute lymphoblastic leukemia.
24447348 An interaction term, between FPGS rs7033913 heterozygotes and GGH rs11988534 homozygotes for the minor allele, had a p-value <0.0001 and may contribute to metotrexate toxicity in rheumatoid arthritis.
23374458 Suggest that GGH may serve as a potential biomarker of unfavorable clinical outcomes over short-term follow-up in breast cancer.
23107767 The results of our study suggested the potential interest of GGH -401C>T as a predictive factor of the outcome of cervical carcinoma treated with cisplatin-based chemoradiotherapy.
22994778 Genotyping of DHFR 829C>T and GGH -401C>T was performed using a polymerase chain reaction.
22763757 GG genotype of GGH -354 T > G polymorphism may have high predictive value for myelosuppression in methotrexate treated rheumatoid arthritis patients.
22678806 There was no significant difference in gamma-glutamyl hydrolase genotype or T allele frequency between the two groups (P> 0.05).
22649255 a SNP in the GGH gene remained associated with reduced CVD risk, with a stronger association in early onset CVD cases.
22568793 Genetic polymorphism of gamma-glutamyl hydrolase in Chinese acute leukemia children and identification of a novel double nonsynonymous mutation.
22018726 This is one of the first studies to assess FPGS and GGH genetic variants in relation to plasma homocysteine.
21538980 Genotypes in GGH gene of acute lymphoblastic leukemia patients were evaluated
20651609 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20197200 The -401C/T polymorphism in the gamma-glutamyl hydrolase may be a factor involved in the generation of relapse to disease in patients with acute lymphoblastic leukemia.
20197200 Observational study of gene-disease association. (HuGE Navigator)
20037791 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19841321 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19827168 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19815704 data implicate GGH as a novel biomarker for bladder cancer; suggest presence of GGH & diazepam-binding inhibitor in urine serves as a rationale for developing them as urinary markers of clinical outcomes for patients treated with neoadjuvant chemotherapy
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19636555 Data revealed that high FPGS gene expression, low GGH gene expression and low ABCC1 gene expression in CRC tissues were predictive factors for a high reduced folate level after LV administration.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19307503 Clinical trial of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19093297 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19016697 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18851872 The genotypes of XRCC1 Arginine194Tryptophan and GGH-401Cytosine/Thymine were associated with the response to NAC in patients with cervical cancer. No SNP genotypes were associated with DFS.
18851872 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18842806 Observational study of gene-disease association. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18414409 CpG island methylator phenotype (CIMP+) in ColoRectal Cancer (CRC) is associated with low expression of GGH, suggesting involvement of the folate pathway in the development of this phenotype.
17409534 Observational study of genotype prevalence. (HuGE Navigator)
17409534 The genotype distribution and gene frequency of the GGH gene polymorphism was studied in a Japanese population.
17286537 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17009228 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16945597 lack of dissociation of the dimer, large monomer-monomer interface, & presence of catalytically essential Tyr-36 in the homodimer interface sequences suggest that homodimer formation is required for hGH monomer to fold into an active conformation.
16875718 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16141796 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15492986 cDNA microarray analysis led to the identification of 2 novel biomarkers that should facilitate molecular diagnosis and further study of pulmonary neuroendocrine tumors.
11953431 Three-dimensional structure

AA Sequence

MASPGCLLCVLGLLLCGAASLELSRPHGDTAKKPIIGILMQKCRNKVMKNYGRYYIAASYVKYLESAGAR      1 - 70
VVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEEL     71 - 140
SLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKL    141 - 210
KKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEAR    211 - 280
KNNHHFKSESEEEKALIYQFSPIYTGNISSFQQCYIFD                                    281 - 318
//

Text Mined References (64)

PMID Year Title
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
25823786 2015 Correlation of genetic polymorphisms with clinical outcomes in pemetrexed-treated advanced lung adenocarcinoma patients.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24908438 2014 Influence of genetic polymorphisms of FPGS, GGH, and MTHFR on serum methotrexate levels in Chinese children with acute lymphoblastic leukemia.
24447348 Folic acid pathway single nucleotide polymorphisms associated with methotrexate significant adverse events in United States veterans with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374458 2013 High levels of ?-glutamyl hydrolase (GGH) are associated with poor prognosis and unfavorable clinical outcomes in invasive breast cancer.
23107767 2013 The impact of GGH -401C>T polymorphism on cisplatin-based chemoradiotherapy response and survival in cervical cancer.
22994778 2012 Association between polymorphisms of dihydrofolate reductase and gamma glutamyl hydrolase genes and toxicity of high dose methotrexate in children with acute lymphoblastic leukemia.
22763757 2013 Association of the TYMS 3G/3G genotype with poor response and GGH 354GG genotype with the bone marrow toxicity of the methotrexate in RA patients.
22678806 2012 [Analysis of a 452C/T single nucleotide polymorphism in ?-glutamyl hydrolase gene in children with acute leukemia].
22649255 2012 Folate network genetic variation predicts cardiovascular disease risk in non-Hispanic white males.
22568793 2012 Genetic polymorphism of ?-glutamyl hydrolase in Chinese acute leukemia children and identification of a novel double nonsynonymous mutation.
22018726 2012 Genetic variation in folylpolyglutamate synthase and gamma-glutamyl hydrolase and plasma homocysteine levels in the Singapore Chinese Health Study.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21538980 2011 Genotyping of single nucleotide polymorphism in ?-glutamyl hydrolase gene by capillary electrophoresis.
21269460 2011 Initial characterization of the human central proteome.
20651609 2010 Correlation between polymorphisms of the reduced folate carrier gene (SLC19A1) and survival after pemetrexed-based therapy in non-small cell lung cancer: a North Central Cancer Treatment Group-based exploratory study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20197200 2010 Polymorphisms of the gamma-glutamyl hydrolase gene and risk of relapse to acute lymphoblastic leukemia in Mexico.
20037791 2010 Genes involved with folate uptake and distribution and their association with colorectal cancer risk.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19841321 2010 Phase II trial of pemetrexed plus bevacizumab for second-line therapy of patients with advanced non-small-cell lung cancer: NCCTG and SWOG study N0426.
19827168 2009 Genetic polymorphisms in folate pathway enzymes as a possible marker for predicting the outcome of methotrexate therapy in Japanese patients with rheumatoid arthritis.
19815704 2009 Genoproteomic mining of urothelial cancer suggests {gamma}-glutamyl hydrolase and diazepam-binding inhibitor as putative urinary markers of outcome after chemotherapy.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19636555 2010 Molecular determinants of folate levels after leucovorin administration in colorectal cancer.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19307503 2009 Randomized phase II and pharmacogenetic study of pemetrexed compared with pemetrexed plus carboplatin in pretreated patients with advanced non-small-cell lung cancer.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19093297 2008 Interaction of genes from influx-metabolism-efflux pathway and their influence on methotrexate efficacy in rheumatoid arthritis patients among Indians.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016697 2009 Outcomes of methotrexate therapy for psoriasis and relationship to genetic polymorphisms.
18851872 2008 XRCC1 Arginine194Tryptophan and GGH-401Cytosine/Thymine polymorphisms are associated with response to platinum-based neoadjuvant chemotherapy in cervical cancer.
18842806 2008 Associations between single nucleotide polymorphisms in folate uptake and metabolizing genes with blood folate, homocysteine, and DNA uracil concentrations.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18414409 2008 Low expression of gamma-glutamyl hydrolase mRNA in primary colorectal cancer with the CpG island methylator phenotype.
17409534 2007 Genetic polymorphism of C452T (T127I) in human gamma-glutamyl hydrolase in a Japanese population.
17286537 2007 Exploratory analysis of four polymorphisms in human GGH and FPGS genes and their effect in methotrexate-treated rheumatoid arthritis patients.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17009228 2006 Pharmacogenomic and metabolic biomarkers in the folate pathway and their association with methotrexate effects during dosage escalation in rheumatoid arthritis.
16945597 2006 Characterization of Human gamma-glutamyl hydrolase in solution demonstrates that the enzyme is a non-dissociating homodimer.
16875718 2006 XRCC1 R399Q polymorphism is associated with response to platinum-based neoadjuvant chemotherapy in bulky cervical cancer.
16141796 2005 The pharmacogenetics of methotrexate in inflammatory bowel disease.
15492986 2004 Identification of carboxypeptidase E and gamma-glutamyl hydrolase as biomarkers for pulmonary neuroendocrine tumors by cDNA microarray.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11953431 2002 Three-dimensional structure of human gamma -glutamyl hydrolase. A class I glatamine amidotransferase adapted for a complex substate.
11005824 2000 Molecular modeling and site-directed mutagenesis define the catalytic motif in human gamma -glutamyl hydrolase.
10598552 1999 Glutamyl hydrolase: properties and pharmacologic impact.
10570974 1999 Structural organization of the human gamma-glutamyl hydrolase gene.
10527932 1999 Site-directed mutagenesis establishes cysteine-110 as essential for enzyme activity in human gamma-glutamyl hydrolase.
9614206 1998 Characterization of human cellular gamma-glutamyl hydrolase.
8816764 1996 Human gamma-glutamyl hydrolase: cloning and characterization of the enzyme expressed in vitro.
8621474 1996 Identification, cloning, and sequencing of a cDNA coding for rat gamma-glutamyl hydrolase.
3759978 1986 Intracellular pteroylpolyglutamate hydrolase from human jejunal mucosa. Isolation and characterization.
2867095 1986 Pteroylpolyglutamate hydrolase from human jejunal brush borders. Purification and characterization.
1713122 1991 Secretion of gamma-glutamyl hydrolase in vitro.