Property Summary

NCBI Gene PubMed Count 27
PubMed Score 142.51
PubTator Score 117.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-02
Breast cancer 1.100 2.1e-05
breast carcinoma 1.100 3.4e-28
ductal carcinoma in situ 1.600 4.7e-04
invasive ductal carcinoma 1.600 1.9e-02
lung adenocarcinoma 1.100 9.0e-09
lung cancer 1.700 3.8e-04
Multiple myeloma 1.407 1.9e-03
nasopharyngeal carcinoma 1.100 7.3e-05
non-small cell lung cancer 1.543 4.3e-25
ovarian cancer 1.900 1.4e-03
Pick disease -1.200 1.7e-05
psoriasis 2.100 7.6e-05
subependymal giant cell astrocytoma 1.618 4.0e-02
Waldenstrons macroglobulinemia 1.257 2.3e-02

Gene RIF (15)

AA Sequence

MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT      1 - 70
IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK     71 - 140
KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL                          141 - 188
//

Text Mined References (29)

PMID Year Title