Property Summary

NCBI Gene PubMed Count 27
PubMed Score 135.04
PubTator Score 117.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.257 2.3e-02
Multiple myeloma 1.407 1.9e-03
astrocytic glioma -1.100 4.2e-02
psoriasis 2.100 7.6e-05
non-small cell lung cancer 1.543 4.3e-25
lung cancer 1.700 3.8e-04
subependymal giant cell astrocytoma 1.618 4.0e-02
lung adenocarcinoma 1.424 1.2e-07
nasopharyngeal carcinoma 1.100 7.3e-05
non-inflammatory breast cancer 1.200 1.8e-02
breast carcinoma 1.100 3.4e-28
Pick disease -1.200 1.7e-05
ductal carcinoma in situ 1.600 4.7e-04
invasive ductal carcinoma 1.600 1.9e-02
ovarian cancer 1.900 1.4e-03

Synonym

Accession O75223 B2RDN0 B8ZZN4 B8ZZR8 Q9BS37
Symbols GGC
GCTG
CRF21
C7orf24

Gene

PDB

2I5T   2PN7   2Q53   2RBH   3CRY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

PMID Text
26828272 GGCT plays a critical role in glioma cell proliferation and may be a potential cancer therapeutic target.
26339607 GGCT is promising as a diagnostic marker and a therapeutic target for various cancers. This review summarizes these interesting findings.
25941902 GGCT plays a critical role in lung cancer cell proliferation.
25818003 G6PD, GGCT, IDH1, isocitrate dehydrogenase 2 (NADP+,mitochondrial) (IDH2) and glutathione S-transferase pi 1(GSTP1), five of the critical components of GSH pathway, contribute to chemoresistance.
24342434 increased expression of GGCT was a common event among invasive esophageal squamous cell carcinoma tissues regardless of the depth of invasion. Lymph node metastasis and tumor differentiation correlated with GGCT expression
23853312 Transcriptional silencing of the C7orf24 gene in the non-malignant cells is elicited through heterochromatin formation in its promoter region.
23513927 C7orf24 has been recognized as a potent marker for bladder and breast cancers. Studies on the role of gamma-glutamylcyclotransferace may aid in the control of malignant transformation of these cancers.
22205682 GGCT may be a biomarker of tumors in a limited range of organs.
20527979 C7orf24 overexpression defines a subgroup of breast tumors with poor clinical outcome.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18515354 The GGCT gene is located on chromosome 7p14-15 and consists of four exons that span 8 kb, the primary sequence is 188 amino acids in length and is unlike any protein of known function
17932939 presence of extra electron density/ligands and conservation at the sequence and structure levels, it is likely that the cavity has a crucial role in the function of LOC79017 and its structural neighbors possibly as an active site or ligand-binding site
16765912 CRF21 might play an important role in the induction of apoptosis by GGO in leukemia U937 cells.

AA Sequence

MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT      1 - 70
IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK     71 - 140
KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL                          141 - 188
//

Text Mined References (29)

PMID Year Title
27658708 2016 Depletion of ?-glutamylcyclotransferase inhibits breast cancer cell growth via cellular senescence induction mediated by CDK inhibitor upregulation.
26828272 2016 Gamma-glutamylcyclotransferase promotes the growth of human glioma cells by activating Notch-Akt signaling.
26339607 2015 Gamma-Glutamylcyclotransferase: A Novel Target Molecule for Cancer Diagnosis and Treatment.
25941902 2015 ?-Glutamylcyclotransferase Knockdown Inhibits Growth of Lung Cancer Cells Through G0/G1 Phase Arrest.
25818003 2015 Identification of proteins responsible for adriamycin resistance in breast cancer cells using proteomics analysis.
24342434 2014 ?-Glutamylcyclotransferase as a novel immunohistochemical biomarker for the malignancy of esophageal squamous tumors.
23853312 2013 Association of epigenetic alterations in the human C7orf24 gene with the aberrant gene expression in malignant cells.
23513927 2012 [C7orf24/gamma-glutamyl cyclotransferase as a molecular target for cancer chemotherapy].
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22205682 2012 Widespread expression of ?-glutamyl cyclotransferase suggests it is not a general tumor marker.
21883928 2011 Multiple NF-Y-binding CCAAT boxes are essential for transcriptional regulation of the human C7orf24 gene, a novel tumor-associated gene.
21508379 2011 Involvement of cancer biomarker C7orf24 in the growth of human osteosarcoma.
21269460 2011 Initial characterization of the human central proteome.
21136669 2007 A novel tumor-related protein, C7orf24, identified by proteome differential display of bladder urothelial carcinoma.
20527979 2010 Proteomic profiling of mammary carcinomas identifies C7orf24, a gamma-glutamyl cyclotransferase, as a potential cancer biomarker.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20110353 2010 Identification and characterization of gamma-glutamylamine cyclotransferase, an enzyme responsible for gamma-glutamyl-epsilon-lysine catabolism.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18515354 2008 The identification and structural characterization of C7orf24 as gamma-glutamyl cyclotransferase. An essential enzyme in the gamma-glutamyl cycle.
17932939 2008 Crystal structure of Homo sapiens protein LOC79017.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16765912 2006 A novel 21-kDa cytochrome c-releasing factor is generated upon treatment of human leukemia U937 cells with geranylgeraniol.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.