Property Summary

NCBI Gene PubMed Count 42
PubMed Score 25.19
PubTator Score 21.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.100 2.6e-02
malignant mesothelioma 2.000 1.6e-07
psoriasis -2.600 7.6e-05
osteosarcoma -2.397 5.5e-08
atypical teratoid / rhabdoid tumor 1.200 1.3e-05
medulloblastoma, large-cell 1.400 5.6e-05
tuberculosis -1.700 6.3e-09
primary pancreatic ductal adenocarcinoma -1.071 4.5e-02
non-small cell lung cancer -1.167 1.7e-21
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-02
lung cancer -1.200 4.0e-02
diabetes mellitus -1.100 1.2e-03
pancreatic carcinoma -1.100 2.6e-02
subependymal giant cell astrocytoma 1.503 2.2e-02
COPD -1.100 4.6e-03
ovarian cancer 1.500 7.0e-04
ileal Crohn's disease -1.023 4.3e-02
dermatomyositis 1.100 9.5e-04

Protein-protein Interaction (9)

Gene RIF (13)

PMID Text
25496667 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
22291915 GGA2 mediates a vital function that cannot be compensated for by GGA1and/or GGA3.
20012524 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19788741 GGA overexpression causes various sorting defects as measured by recycling of CD-MPR, internalization of transferrin receptor, and the subcellular localization of proteins like Tsg101, ubiquitin, and Hrs.
18638397 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18439901 Genome-wide shRNA screening identifies GGA2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18431031 GGA2 is recruited to the trans-Golgi network independently of the other Golgi-localized, gamma-ear-containing, ARF-binding proteins and is required for the efficient sorting of lysosomal enzymes
17596511 p56 tightly cooperates with the GGAs in the sorting of cathepsin D to lysosomes, probably by enabling the movement of GGA-containing transport carriers.
17494868 These results show that the dual roles of PI4P can promote specific GGA targeting and cargo recognition at the trans-Golgi network.
17451558 Results demonstrate that cargo proteins contribute to the recruitment of GGA2 onto membranes and to the formation of GGA-positive clathrin-coated vesicles.
15615712 GGA proteins function with the phosphorylated ACDL in the memasin 2-recycling pathway from endosomes to trans Golgi on the way back to the cell surface.
12135764 endocytosis and intracellular transport of memapsin 2, mediated by its cytosolic domain, may involve the binding of GGA1 and GGA2

AA Sequence

MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHK      1 - 70
IQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTV     71 - 140
WFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAA    141 - 210
NRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLF    211 - 280
RLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLI    281 - 350
DLEVDNGPAQMGTVVPSLLHQDLAALGISDAPVTGMVSGQNCCEEKRNPSSSTLPGGGVQNPSADRNLLD    351 - 420
LLSAQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTPLAQVFVPLESVKPSSLPPLI    421 - 490
VYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPL    491 - 560
MPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA                     561 - 613
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22291915 2012 Analysis of Gga null mice demonstrates a non-redundant role for mammalian GGA2 during development.
21269460 2011 Initial characterization of the human central proteome.
19788741 2009 Defects in cellular sorting and retroviral assembly induced by GGA overexpression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19478182 2009 A role for the CHC22 clathrin heavy-chain isoform in human glucose metabolism.
18431031 2007 Specific depletion of GGA2 causes cathepsin D missorting in HeLa cells.
17596511 2007 The trans-Golgi network accessory protein p56 promotes long-range movement of GGA/clathrin-containing transport carriers and lysosomal enzyme sorting.
17494868 2007 PI4P promotes the recruitment of the GGA adaptor proteins to the trans-Golgi network and regulates their recognition of the ubiquitin sorting signal.
17451558 2007 The role of cargo proteins in GGA recruitment.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15615712 2005 GGA proteins mediate the recycling pathway of memapsin 2 (BACE).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15039775 2004 Interactions of GGA3 with the ubiquitin sorting machinery.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14665628 2004 Definition of the consensus motif recognized by gamma-adaptin ear domains.
14638859 2003 Mammalian GGAs act together to sort mannose 6-phosphate receptors.
14567678 2003 Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.
12808037 2003 Binding partners for the COOH-terminal appendage domains of the GGAs and gamma-adaptin.
12606052 2003 Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket.
12505986 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429846 2002 Clint: a novel clathrin-binding ENTH-domain protein at the Golgi.
12213833 2002 Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.
12135764 2002 Memapsin 2 (beta-secretase) cytosolic domain binds to the VHS domains of GGA1 and GGA2: implications on the endocytosis mechanism of memapsin 2.
11950392 2002 GGA proteins associate with Golgi membranes through interaction between their GGAH domains and ADP-ribosylation factors.
11886874 2002 Interaction of the cation-dependent mannose 6-phosphate receptor with GGA proteins.
11821067 2002 The sorLA cytoplasmic domain interacts with GGA1 and -2 and defines minimum requirements for GGA binding.
11390366 2001 Golgi-localizing, gamma-adaptin ear homology domain, ADP-ribosylation factor-binding (GGA) proteins interact with acidic dileucine sequences within the cytoplasmic domains of sorting receptors through their Vps27p/Hrs/STAM (VHS) domains.
11387476 2001 Binding of GGA2 to the lysosomal enzyme sorting motif of the mannose 6-phosphate receptor.
11387475 2001 Sorting of mannose 6-phosphate receptors mediated by the GGAs.
11331584 2001 The sortilin cytoplasmic tail conveys Golgi-endosome transport and binds the VHS domain of the GGA2 sorting protein.
11301005 2001 The GGAs promote ARF-dependent recruitment of clathrin to the TGN.
10814529 2000 Adaptor gamma ear homology domain conserved in gamma-adaptin and GGA proteins that interact with gamma-synergin.
10749927 2000 A family of ADP-ribosylation factor effectors that can alter membrane transport through the trans-Golgi.
10747089 2000 GGAs: a family of ADP ribosylation factor-binding proteins related to adaptors and associated with the Golgi complex.
10747088 2000 A family of proteins with gamma-adaptin and VHS domains that facilitate trafficking between the trans-Golgi network and the vacuole/lysosome.
10702286 2000 Vear, a novel Golgi-associated protein with VHS and gamma-adaptin "ear" domains.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.