Property Summary

NCBI Gene PubMed Count 63
PubMed Score 78.67
PubTator Score 44.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.0e-05
psoriasis 6685 1.2e-05
ovarian cancer 8491 9.5e-04
astrocytoma 1493 3.7e-03
oligodendroglioma 2849 7.8e-03
primitive neuroectodermal tumor 3031 9.2e-03
ependymoma 2514 1.0e-02
sarcoidosis 368 2.9e-02
group 4 medulloblastoma 1875 3.7e-02
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.504 1.8

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.200 1.0e-02
oligodendroglioma 1.500 7.8e-03
psoriasis 2.200 1.2e-05
osteosarcoma 2.923 1.0e-05
astrocytoma 1.400 3.7e-03
primitive neuroectodermal tumor 1.200 9.2e-03
sarcoidosis -1.100 2.9e-02
group 4 medulloblastoma 1.100 3.7e-02
ovarian cancer -1.400 9.5e-04

Gene RIF (28)

PMID Text
25496667 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24866237 These findings show that the AD-like phenotype of NPC model cells can be partly reverted by promoting a non-amyloidogenic processing of APP through the upregulation of GGA1 supporting its preventive role against AD
24407285 These data indicate that clathrin is required for the function of AP-1- and GGA-coated carriers at the trans-Golgi network but may be dispensable for outward traffic en route to the plasma membrane.
22621900 On basis of these results, propose that GGA1 facilitates LR11 endocytic traffic and that LR11 modulates A-beta levels by promoting amyloid-beta precursor protein traffic to the endocytic recycling compartment
22004035 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
21841072 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
20012524 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
19788741 GGA overexpression causes various sorting defects as measured by recycling of CD-MPR, internalization of transferrin receptor, and the subcellular localization of proteins like Tsg101, ubiquitin, and Hrs.
19788741 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18638397 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
18439901 Genome-wide shRNA screening identifies GGA1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
17596511 p56 tightly cooperates with the GGAs in the sorting of cathepsin D to lysosomes, probably by enabling the movement of GGA-containing transport carriers.
17506864 the interaction between the hinge region and the GAE domain underlies the autoregulation of GGA function in clathrin-mediated trafficking through competing with the accessory proteins and the AP-1 complex
17494868 These results show that the dual roles of PI4P can promote specific GGA targeting and cargo recognition at the trans-Golgi network.
17151287 GGA1 alters the proteolytic processing of beta-amyloid precursor protein (APP) and the secretion of APPs and amyloid-beta, suggesting a role of GGA1 in Alzheimer's disease pathogenesis.
17005855 GGA1 prevented APP beta-cleavage products from becoming substrates for gamma-secretase. Direct binding of GGA1 to BACE was not required for these effects, but the integrity of the GAT (GGA1 and TOM) domain of GGA1 was.
16407204 the trafficking of adiponectin through its secretory pathway is dependent on GGA-coated vesicles
15886016 Our data indicate that GGA proteins are not only involved in the sorting at the TGN but also mediate the retrograde transport of cargo proteins from endosomes to the TGN.
15615712 GGA proteins funstion with the phosphorylated ACDL in the memasin 2-recycling pathway from endosomes to trans Golgi on the way back to the cell surface.
15466887 serine phosphorylation of BACE is a physiologically relevant post-translational modification that regulates trafficking in the juxtanuclear compartment by interaction with GGA1
15143060 Rabaptin-5, ubiquitin, and TSG101 bind to overlapping but distinct binding sites on the trihelical bundle subdomain of GGA-1 protein
14973137 GGA1 interacts with the adaptor protein AP-1 through a WNSF sequence in its hinge region
14636058 A hydrophobic surface patch on the C-terminal three-helix bundle motif of the GGA1 GAT domain is directly involved in binding with a coiled-coil region of rabaptin-5.
12767220 Crystal structure of the human GGA1 GAT domain
12679809 X-ray crystal structures of the human GGA1-GAT domain and the complex between ARF1-GTP and the N-terminal region of the GAT domain
12668765 The 2.4-A crystal structure of the GAT domain of human GGA1 reveals a three-helix bundle, with a long N-terminal helical extension that is not conserved in GAT domains that do not bind ARF.
12135764 endocytosis and intracellular transport of memapsin 2, mediated by its cytosolic domain, may involve the binding of GGA1 and GGA2
11859376 X-ray structure of the GGA1 VHS domain alone, and in complex with the carboxy-terminal peptide of cation-independent mannose 6-phosphate receptor containing an ACLL sequence

AA Sequence

MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVL      1 - 70
ETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLK     71 - 140
KQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK    141 - 210
ISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEI    211 - 280
LQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQP    281 - 350
SASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL    351 - 420
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQP    421 - 490
VPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVF    491 - 560
QSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQF    561 - 630
PPPETWGSL                                                                 631 - 639
//

Text Mined References (72)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24866237 2014 GGA1 overexpression attenuates amyloidogenic processing of the amyloid precursor protein in Niemann-Pick type C cells.
24407285 2014 Clathrin terminal domain-ligand interactions regulate sorting of mannose 6-phosphate receptors mediated by AP-1 and GGA adaptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22621900 2012 GGA1-mediated endocytic traffic of LR11/SorLA alters APP intracellular distribution and amyloid-? production.
22522702 2012 Structural basis for Arf6-MKLP1 complex formation on the Flemming body responsible for cytokinesis.
21269460 2011 Initial characterization of the human central proteome.
20676133 2010 Multiple modification and protein interaction signals drive the Ring finger protein 11 (RNF11) E3 ligase to the endosomal compartment.
20214818 2010 Enhancing metabolomic data analysis with Progressive Consensus Alignment of NMR Spectra (PCANS).
20211637 2010 Thirst and hydration: physiology and consequences of dysfunction.
19946888 2010 Defining the membrane proteome of NK cells.
19788741 2009 Defects in cellular sorting and retroviral assembly induced by GGA overexpression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18418388 2008 Yeast and human Ysl2p/hMon2 interact with Gga adaptors and mediate their subcellular distribution.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17855360 2007 SorLA/LR11 regulates processing of amyloid precursor protein via interaction with adaptors GGA and PACS-1.
17596511 2007 The trans-Golgi network accessory protein p56 promotes long-range movement of GGA/clathrin-containing transport carriers and lysosomal enzyme sorting.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17506864 2007 Molecular basis for autoregulatory interaction between GAE domain and hinge region of GGA1.
17494868 2007 PI4P promotes the recruitment of the GGA adaptor proteins to the trans-Golgi network and regulates their recognition of the ubiquitin sorting signal.
17151287 2006 GGA1 is expressed in the human brain and affects the generation of amyloid beta-peptide.
17005855 2006 GGA1 acts as a spatial switch altering amyloid precursor protein trafficking and processing.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16407204 2006 Intracellular trafficking and secretion of adiponectin is dependent on GGA-coated vesicles.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15886016 2005 GGA proteins regulate retrograde transport of BACE1 from endosomes to the trans-Golgi network.
15775984 2005 Gamma-BAR, a novel AP-1-interacting protein involved in post-Golgi trafficking.
15615712 2005 GGA proteins mediate the recycling pathway of memapsin 2 (BACE).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466887 2004 Demonstration of BACE (beta-secretase) phosphorylation and its interaction with GGA1 in cells by fluorescence-lifetime imaging microscopy.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15457209 2004 Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15143060 2004 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites.
15039775 2004 Interactions of GGA3 with the ubiquitin sorting machinery.
14973137 2004 GGA1 interacts with the adaptor protein AP-1 through a WNSF sequence in its hinge region.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14665628 2004 Definition of the consensus motif recognized by gamma-adaptin ear domains.
14660606 2004 GAT (GGA and Tom1) domain responsible for ubiquitin binding and ubiquitination.
14638859 2003 Mammalian GGAs act together to sort mannose 6-phosphate receptors.
14637142 2003 Crystal structure of nitrile hydratase from a thermophilic Bacillus smithii.
14636058 2003 The interaction of the human GGA1 GAT domain with rabaptin-5 is mediated by residues on its three-helix bundle.
14567678 2003 Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.
12858163 2003 Structural basis for binding of accessory proteins by the appendage domain of GGAs.
12808037 2003 Binding partners for the COOH-terminal appendage domains of the GGAs and gamma-adaptin.
12767220 2003 Crystal structure of the human GGA1 GAT domain.
12679809 2003 Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport.
12668765 2003 Structure of the GAT domain of human GGA1: a syntaxin amino-terminal domain fold in an endosomal trafficking adaptor.
12636914 2003 The structure of the GGA1-GAT domain reveals the molecular basis for ARF binding and membrane association of GGAs.
12578827 2003 Phosphorylation-induced conformational changes regulate GGAs 1 and 3 function at the trans-Golgi network.
12538641 2003 EpsinR: an AP1/clathrin interacting protein involved in vesicle trafficking.
12505986 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135764 2002 Memapsin 2 (beta-secretase) cytosolic domain binds to the VHS domains of GGA1 and GGA2: implications on the endocytosis mechanism of memapsin 2.
12060753 2002 Autoinhibition of the ligand-binding site of GGA1/3 VHS domains by an internal acidic cluster-dileucine motif.
11950392 2002 GGA proteins associate with Golgi membranes through interaction between their GGAH domains and ADP-ribosylation factors.
11859376 2002 Structural basis for recognition of acidic-cluster dileucine sequence by GGA1.
11821067 2002 The sorLA cytoplasmic domain interacts with GGA1 and -2 and defines minimum requirements for GGA binding.
11390366 2001 Golgi-localizing, gamma-adaptin ear homology domain, ADP-ribosylation factor-binding (GGA) proteins interact with acidic dileucine sequences within the cytoplasmic domains of sorting receptors through their Vps27p/Hrs/STAM (VHS) domains.
11387475 2001 Sorting of mannose 6-phosphate receptors mediated by the GGAs.
11301005 2001 The GGAs promote ARF-dependent recruitment of clathrin to the TGN.
10814529 2000 Adaptor gamma ear homology domain conserved in gamma-adaptin and GGA proteins that interact with gamma-synergin.
10749927 2000 A family of ADP-ribosylation factor effectors that can alter membrane transport through the trans-Golgi.
10747089 2000 GGAs: a family of ADP ribosylation factor-binding proteins related to adaptors and associated with the Golgi complex.
10747088 2000 A family of proteins with gamma-adaptin and VHS domains that facilitate trafficking between the trans-Golgi network and the vacuole/lysosome.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.