Property Summary

NCBI Gene PubMed Count 28
PubMed Score 8.95
PubTator Score 27.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.900 9.0e-05
medulloblastoma -1.500 5.1e-03
atypical teratoid / rhabdoid tumor -2.000 2.7e-09
medulloblastoma, large-cell -1.800 1.5e-05
primitive neuroectodermal tumor -1.500 4.1e-03
pediatric high grade glioma -1.500 1.8e-05
pilocytic astrocytoma -1.400 3.5e-06
invasive ductal carcinoma -1.100 3.4e-03
pituitary cancer 1.200 1.0e-02

 CSPA Cell Line (2)

Gene RIF (18)

PMID Text
24974787 GFRA2 variants associated with diabetic neuropathic pain.
24402129 GFRalpha2 is under-expressed in functioning adenomas and over-expressed in non-functioning adenomas, specifically gonadotropinomas
24139947 In the cochlea, immunolabeling for GFRalpha-2 receptors was identified mainly in the cell bodies of the spiral neurons than in the nerve fibers. No structures in the organ of Corti were labeled with GFRalpha-2 receptor antibody
24067900 GFRalpha-2 is associated with severe abdominal pain sensation in pancreatic cancer patients.
23881409 The study shows co-localization of RET with GFRA1 and GFRA2 in myenteric ganglia of the adult human colon.
21723942 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFRalpha2 isoforms.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20369355 GFRA2 genetic variants, and age, may play a role in susceptibility to tardive dyskinesia.
20369355 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20116071 This study found nominally-significant evidence for interactions between GFRA1, 2 and 3 associated with schizophrenia and clozapine response, consistent with the locations of these three genes within linkage regions for schizophrenia.
20116071 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19860791 Observational study of gene-disease association. (HuGE Navigator)
19573479 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18521090 Genome-wide association study of gene-disease association. (HuGE Navigator)
17825269 GFRalpha-2 were observed within sensory and motor nuclei of cranial nerves, dorsal column nuclei, olivary nuclear complex, reticular formation, pontine nuclei, locus caeruleus, raphe nuclei, substantia nigra, and quadrigeminal plate.
17522305 Both GFR alpha2a and GFR alpha2c, but not GFR alpha2b, promote neurite outgrowth in transfected Neuro2A cells.
12624147 Observational study of gene-disease association. (HuGE Navigator)
12490080 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRN      1 - 70
TMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFR     71 - 140
LASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDR    141 - 210
VPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQ    211 - 280
TVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRN    281 - 350
AIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSM    351 - 420
CFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL                              421 - 464
//

Text Mined References (29)

PMID Year Title
24974787 2015 A genome-wide association study suggests an association of Chr8p21.3 (GFRA2) with diabetic neuropathic pain.
24402129 2015 Expression of the pituitary stem/progenitor marker GFR?2 in human pituitary adenomas and normal pituitary.
24139947 2014 Immunohistological analysis of neurturin and its receptors in human cochlea.
24067900 2014 The neurotrophic factor neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
23881409 2013 Site-specific gene expression and localization of growth factor ligand receptors RET, GFR?1 and GFR?2 in human adult colon.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
21723942 2011 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFR?2 isoforms.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20369355 2010 Glial cell line-derived neurotrophic factor receptor alpha 2 (GFRA2) gene is associated with tardive dyskinesia.
20116071 2010 Genetic association of the GDNF alpha-receptor genes with schizophrenia and clozapine response.
19860791 2010 Genetic evidence for a role of IL33 in nasal polyposis.
19573479 2009 Applicability of a genetic signature for enhanced iloperidone efficacy in the treatment of schizophrenia.
18521090 2009 Association of the NPAS3 gene and five other loci with response to the antipsychotic iloperidone identified in a whole genome association study.
17825269 2007 Tissue distribution of Ret, GFRalpha-1, GFRalpha-2 and GFRalpha-3 receptors in the human brainstem at fetal, neonatal and adult age.
17522305 2007 Glial cell line-derived neurotrophic factor and neurturin inhibit neurite outgrowth and activate RhoA through GFR alpha 2b, an alternatively spliced isoform of GFR alpha 2.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12624147 2003 Investigation of germline GFRA4 mutations and evaluation of the involvement of GFRA1, GFRA2, GFRA3, and GFRA4 sequence variants in Hirschsprung disease.
12490080 2002 Evaluation of germline sequence variants of GFRA1, GFRA2, and GFRA3 genes in a cohort of Spanish patients with sporadic medullary thyroid cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11409869 2001 Cloning and characterization of the human GFRA2 locus and investigation of the gene in Hirschsprung disease.
10829012 2000 Binding of GDNF and neurturin to human GDNF family receptor alpha 1 and 2. Influence of cRET and cooperative interactions.
10774729 2000 GFRalpha-mediated localization of RET to lipid rafts is required for effective downstream signaling, differentiation, and neuronal survival.
9407096 1997 GFRalpha-2 and GFRalpha-3 are two new receptors for ligands of the GDNF family.
9259272 1997 Cloning, mRNA distribution and chromosomal localisation of the gene for glial cell line-derived neurotrophic factor receptor beta, a homologue to GDNFR-alpha.
9192898 1997 A GPI-linked protein that interacts with Ret to form a candidate neurturin receptor.
9182803 1997 TrnR2, a novel receptor that mediates neurturin and GDNF signaling through Ret.
9177201 1997 Glial cell line-derived neurotrophic factor-dependent RET activation can be mediated by two different cell-surface accessory proteins.