Property Summary

NCBI Gene PubMed Count 54
PubMed Score 163.04
PubTator Score 156.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 3.1e-03
osteosarcoma -4.726 2.6e-09
lung cancer -1.400 3.7e-03

Gene RIF (37)

PMID Text
27143377 Gfi1 gene expression is regulated by cytokines in activated T cells.
26447191 Gfi1 acts as a transcriptional repressor by recruiting histone-modifying enzymes to promoters and enhancers of target genes. Mutations of the C-terminal zinc finger domain causes congenital neutropenia. It may be involved in leukemia and lymphoma. Review.
26160036 miR-495 directly interacts with the Gfi1 3'UTR to regulate Gfi1 at a post-transcriptional level and the expression level of miR-495 is inversely correlated with the Gfi1 protein level in medulloblastoma specimens.
25043047 results, supported by evidence from mouse models, identify GFI1 and GFI1B as prominent medulloblastoma oncogenes and implicate 'enhancer hijacking' as an efficient mechanism driving oncogene activation in a childhood cancer
24830456 During infection, the incoming HCMV rapidly downregulates the GFI1 mRNA and protein in both wild-type cells and in cells in which EZH2, NDY1/KDM2B or JARID2 were knocked down.
24198842 Lymphoid progenitor cells from childhood acute lymphoblastic leukemia are functionally deficient and express high levels of the transcriptional repressor Gfi-1.
24121275 Data shows that MYB regulates the expression of endogenous human GFI1.
24023884 GFI1 is repressed by p53
24018353 the expression of Gfi-1 contributes to SOCS1 silencing in AML cells through epigenetic modification, and suppression of histone methyltransferase can provide new insight in AML therapy.
23528269 Studies indicate that Gfi1 recruits LSD1 to p53 and dampens its activity by de-methylating p53 at C-terminal lysines to prevent immediate apoptosis.
23466061 The competition for this binding site inhibits the expression of HOXA9 and induces different transcriptional outcomes, which suggests a new direction for investigation of the mechanism underlying targeted therapy of malignant gliomas.
22932805 Our data suggest that the presence of a GFI136N variant allele induces a preleukemic state in myeloid precursors by deregulating the expression of Hoxa9 and other AML-related genes.
22042697 Data suggest that Gfi1 may have an important role in prolonged multiple myeloma (MM)-induced osteoblast (OB) suppression and provide a new therapeutic target for MM bone disease.
20723286 GFI-1 expression is upregulated in leukemia patients and may contribute to leukemogenesis.
20723283 GFI1 may play an important role in leukemia, especially in CML incidence and progression.
20571393 Studies indicate that Gfi1 is central to several transcriptional circuits whose dysregulation leads to abnormal or malignant hematopoiesis.
20087403 An analysis and fine mapping of GFI-EVI5-RPL5-FAM69A locus, genotyping eight Tag-single nucleotide polymorphisms in 732 multiple sclerosis patients and 974 controls from Spain, was performed.
20087403 Observational study of gene-disease association. (HuGE Navigator)
20075157 a variant allele of GFI1 (GFI1(36N)) is associated with acute myeloid leukemia (AML) in white subjects
20075157 Observational study of gene-disease association. (HuGE Navigator)
19887785 Gfi1 mRNA level in both the mononuclear cells and purified CD34(+) cells from CML were significantly higher as measured by quantitative real-time PCR.
19506020 Data suggest that expression of PFAAP5 allows neutrophil elastase to potentiate the repression of Gfi1 target genes.
19164764 data reveal a mechanism of transcriptional repression by Gfi-1 and may have important implications for understanding the roles of Gfi-1 in normal development and tumorigenesis
19026687 These results reveal novel contributions of MTGR1 and GFI1 to the regulation of neurite outgrowth and identify novel repressors of integrin-dependent neurite outgrowth.
18805794 Ajuba is utilized as a corepressor selectively on Gfi1 target genes
18701459 the T cell receptor-mediated induction of Gfi1 controls Th2 cell differentiation through the regulation of GATA3 protein stability
18371060 The measurement of CD34 and GFI1 mRNA expressions could be useful as a diagnostic and prognostic marker for myelodysplastic syndrome.
17646546 The fine-tuning of Gfi1 protein levels regulated by Triad1 defines an unexpected role for this protein in hematopoiesis.
17636019 Results identify PRDM5, which acts as a sequence-specific, DNA binding transcription factor that targets hematopoiesis-associated protein-coding and microRNA genes, some of which are targets of Gfi1.
17244686 Decreased Gfi-1 levels in our SGD patient, together with the mutant C/EBPepsilon, block secondary granules proteins expression, thereby contributing to the underlying etiology of the disease in our patient.
17213822 the interaction between ETS1 and GFI1 facilitates their binding to specific sites on the Bax promoter and represses Bax expression
17207994 GFI1 may play a significant role in the down regulation of endogenous production of 1,25D in prostate cancer cells and could provide a novel insight to future diagnosis and treatment
16888099 Gfi1 levels are regulated by the ubiquitin-proteasome system. It binds the promoters of several granulocyte-specific genes in primary monocytes. This correlated with low expression of these genes in monocytes compared with granulocytes.
16287849 findings highlight the role of epigenetics in the regulation of development and oncogenesis by Gfi1
15947108 GFI1 in prostate cancer cells acts as a repressor of 25-hydroxyvitamin D 1-alpha hydroxylase gene.
15131254 role for auto- and trans-regulation of Gfi1 by GFI1 and GFI1B in maintaining the normal expression patterns of Gfi1
12778173 Mutations in proto-oncogene GFI1 cause human neutropenia and target ELA2

AA Sequence

MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASA      1 - 70
SPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYR     71 - 140
PCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGL    141 - 210
YERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSG    211 - 280
TRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFH    281 - 350
QKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG    351 - 420
LK                                                                        421 - 422
//

Text Mined References (54)

PMID Year Title
27143377 [Cytokine-mediated regulation of expression of Gfi1 and U2afll4 genes activated by T-cells with different differentiation status in vitro].
26447191 2015 From cytopenia to leukemia: the role of Gfi1 and Gfi1b in blood formation.
26160036 2015 MiR-495 is a Predictive Biomarker that Downregulates GFI1 Expression in Medulloblastoma.
25043047 2014 Enhancer hijacking activates GFI1 family oncogenes in medulloblastoma.
24830456 2014 The downregulation of GFI1 by the EZH2-NDY1/KDM2B-JARID2 axis and by human cytomegalovirus (HCMV) associated factors allows the activation of the HCMV major IE promoter and the transition to productive infection.
24198842 2013 Lymphoid progenitor cells from childhood acute lymphoblastic leukemia are functionally deficient and express high levels of the transcriptional repressor Gfi-1.
24121275 2014 The MYB proto-oncogene suppresses monocytic differentiation of acute myeloid leukemia cells via transcriptional activation of its target gene GFI1.
24023884 2013 GFI1 is repressed by p53 and inhibits DNA damage-induced apoptosis.
24018353 2014 Gfi-1 is the transcriptional repressor of SOCS1 in acute myeloid leukemia cells.
23528269 2013 Growth factor independence 1 (Gfi1) as a regulator of p53 activity and a new therapeutical target for ALL.
23466061 2013 Potential roles for Gfi1 in the pathogenesis and proliferation of glioma.
22932805 2012 The human GFI136N variant induces epigenetic changes at the Hoxa9 locus and accelerates K-RAS driven myeloproliferative disorder in mice.
22042697 2011 Gfi1 expressed in bone marrow stromal cells is a novel osteoblast suppressor in patients with multiple myeloma bone disease.
21570500 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1.
20723286 2010 [Gfi-1 expression in leukemia patients and inhibitory effects of lentiviral vector mediated silence of Gfi-1 gene on proliferation in K562 cells].
20723283 2010 [Expression of growth-factor independence 1 in patients with leukemia and its significance].
20571393 2010 Gfi1-cells and circuits: unraveling transcriptional networks of development and disease.
20547752 2010 Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65.
20190815 2010 A role of Miz-1 in Gfi-1-mediated transcriptional repression of CDKN1A.
20087403 2010 Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis.
20075157 2010 A variant allele of Growth Factor Independence 1 (GFI1) is associated with acute myeloid leukemia.
19887785 2010 The growth factor independence-1 (Gfi1) is overexpressed in chronic myelogenous leukemia.
19506020 2009 Contributions to neutropenia from PFAAP5 (N4BP2L2), a novel protein mediating transcriptional repressor cooperation between Gfi1 and neutrophil elastase.
19164764 2009 Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1.
19026687 2009 Loss of function genetic screens reveal MTGR1 as an intracellular repressor of beta1 integrin-dependent neurite outgrowth.
18805794 2008 Ajuba functions as a histone deacetylase-dependent co-repressor for autoregulation of the growth factor-independent-1 transcription factor.
18701459 2008 Gfi1-mediated stabilization of GATA3 protein is required for Th2 cell differentiation.
18371060 2009 CD34, RAB20, PU.1 and GFI1 mRNA expression in myelodysplastic syndrome.
17909014 2007 The Ajuba LIM domain protein is a corepressor for SNAG domain mediated repression and participates in nucleocytoplasmic Shuttling.
17646546 2007 Gfi1 ubiquitination and proteasomal degradation is inhibited by the ubiquitin ligase Triad1.
17636019 2007 Epigenetic regulation of protein-coding and microRNA genes by the Gfi1-interacting tumor suppressor PRDM5.
17244686 2007 Growth factor independence-1 (Gfi-1) plays a role in mediating specific granule deficiency (SGD) in a patient lacking a gene-inactivating mutation in the C/EBPepsilon gene.
17213822 2007 Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression.
17207994 2007 Role of oncoprotein growth factor independent-1 (GFI1) in repression of 25-hydroxyvitamin D 1alpha-hydroxylase (CYP27B1): a comparative analysis in human prostate cancer and kidney cells.
17197705 2007 The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction.
16888099 2007 Diminished proteasomal degradation results in accumulation of Gfi1 protein in monocytes.
16716599 2006 The growth factor independence-1 transcription factor: new functions and new insights.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319680 2006 Zinc-finger transcription factor Gfi-1: versatile regulator of lymphocytes, neutrophils and hematopoietic stem cells.
16287849 2005 Gfi1 coordinates epigenetic repression of p21Cip/WAF1 by recruitment of histone lysine methyltransferase G9a and histone deacetylase 1.
15947108 2005 Identification of growth factor independent-1 (GFI1) as a repressor of 25-hydroxyvitamin D 1-alpha hydroxylase (CYP27B1) gene expression in human prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131254 2004 Targeted transcriptional repression of Gfi1 by GFI1 and GFI1B in lymphoid cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874834 2003 Gfi-1 attaches to the nuclear matrix, associates with ETO (MTG8) and histone deacetylase proteins, and represses transcription using a TSA-sensitive mechanism.
12778173 2003 Mutations in proto-oncogene GFI1 cause human neutropenia and target ELA2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351384 2002 Erythroid expansion mediated by the Gfi-1B zinc finger protein: role in normal hematopoiesis.
11060035 2000 The zinc finger protein Gfi-1 can enhance STAT3 signaling by interacting with the STAT3 inhibitor PIAS3.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9051000 1997 Cloning of the human Gfi-1 gene and its mapping to chromosome region 1p22.
8754800 1996 Gfi-1 encodes a nuclear zinc finger protein that binds DNA and functions as a transcriptional repressor.
8441411 1993 Progression of interleukin-2 (IL-2)-dependent rat T cell lymphoma lines to IL-2-independent growth following activation of a gene (Gfi-1) encoding a novel zinc finger protein.
7789186 1995 Chromosomal localization of a gene, GF1, encoding a novel zinc finger protein reveals a new syntenic region between man and rodents.