Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.04
PubTator Score 9.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.1e-07
Disease Target Count Z-score Confidence
Muscular atrophy 67 4.64 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.131 1.1e-07

Gene RIF (4)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 7 (GEMIN7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
16159890 Unrip is recruited to the active SMN complex via a stable interaction with Gemin7
12065586 Identification and characterization a novel protein component of the survival of motor neurons complex termed Gemin7 using native purified SMN complexes and peptide sequencing by mass spectrometry

AA Sequence

MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSL      1 - 70
LAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP              71 - 131
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16159890 2005 Unrip, a factor implicated in cap-independent translation, associates with the cytosolic SMN complex and influences its intracellular localization.
15939020 2005 The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure.
15848170 2005 Unrip is a component of SMN complexes active in snRNP assembly.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065586 2002 Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.
10531003 1999 Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.